Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.72
PubTator Score 1.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
ependymoma -1.600 2.8e-02
Barrett's esophagus -1.500 2.0e-02
esophageal adenocarcinoma -2.100 2.3e-02
psoriasis -1.500 7.6e-08
glioblastoma multiforme -1.200 1.1e-13
osteosarcoma 1.155 4.3e-02
atypical teratoid / rhabdoid tumor -1.200 6.6e-04
medulloblastoma, large-cell -1.200 9.5e-04
non-small cell lung cancer -1.216 5.7e-09
Common variable immunodeficiency -1.099 2.1e-02
intraductal papillary-mucinous neoplasm ... -2.700 8.1e-03
lung cancer -2.200 1.5e-05
colon cancer -1.900 1.9e-04
interstitial cystitis -1.100 7.2e-05
lung adenocarcinoma -1.500 6.8e-06
subependymal giant cell astrocytoma -1.679 1.9e-02
lung carcinoma 1.300 2.0e-20
Alzheimer's disease -1.300 1.6e-02
Pick disease -1.700 9.2e-06
progressive supranuclear palsy -1.300 1.8e-02
Breast cancer -1.400 5.2e-05
ovarian cancer 2.100 1.2e-03

Synonym

Accession Q9NWD9
Symbols BEXL1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRH      1 - 70
IEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP                         71 - 120
//

Text Mined References (5)

PMID Year Title
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
15958283 2005 Characterization of the Bex gene family in humans, mice, and rats.
15772651 2005 The DNA sequence of the human X chromosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.