Property Summary

NCBI Gene PubMed Count 23
PubMed Score 81.40
PubTator Score 48.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
pancreatic cancer 1.600 1.4e-04
Waldenstrons macroglobulinemia 1.322 2.2e-02
ependymoma -1.100 4.3e-02
psoriasis 1.100 6.7e-04
osteosarcoma 1.057 3.3e-02
Duchenne muscular dystrophy 1.389 1.1e-08
intraductal papillary-mucinous carcinoma... -1.100 2.2e-02
intraductal papillary-mucinous neoplasm ... -2.200 3.5e-02
pancreatic carcinoma 1.600 1.4e-04
lung adenocarcinoma -1.100 3.2e-03
nasopharyngeal carcinoma 1.400 2.3e-04
ovarian cancer -1.700 2.6e-05
dermatomyositis 1.300 1.1e-03

Gene RIF (3)

PMID Text
16777077 DRG-1 may contribute to the dopamine-induced cell growth, which is negatively regulated by NADE
12739005 suppresses cell growth in vivo, when expressed in cultured cells
11830582 Structure-function analysis of NADE: identification of regions that mediate nerve growth factor-induced apoptosis

AA Sequence

MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIF      1 - 70
MEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP                                  71 - 111
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17355907 2007 The TSC1 gene product hamartin interacts with NADE.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16777077 2006 Characterization of human dopamine responsive protein DRG-1 that binds to p75NTR-associated cell death executor NADE.
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15958283 2005 Characterization of the Bex gene family in humans, mice, and rats.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15178455 2004 Direct interaction of Smac with NADE promotes TRAIL-induced apoptosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12739005 2003 NADE (p75NTR-associated cell death executor) suppresses cellular growth in vivo.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11830582 2002 Structure-function analysis of NADE: identification of regions that mediate nerve growth factor-induced apoptosis.
11278287 2001 14-3-3 is involved in p75 neurotrophin receptor-mediated signal transduction.
11238738 2001 Phosphoinositide 3-kinase regulates crosstalk between Trk A tyrosine kinase and p75(NTR)-dependent sphingolipid signaling pathways.
10764727 2000 NADE, a p75NTR-associated cell death executor, is involved in signal transduction mediated by the common neurotrophin receptor p75NTR.
10544233 1999 Functional interaction of Fas-associated phosphatase-1 (FAP-1) with p75(NTR) and their effect on NF-kappaB activation.
10514511 1999 TRAF family proteins interact with the common neurotrophin receptor and modulate apoptosis induction.
7757816 1995 [IMAGE: molecular integration of the analysis of the human genome and its expression].
2171551 1990 Characterization of three abundant mRNAs from human ovarian granulosa cells.