Property Summary

NCBI Gene PubMed Count 21
PubMed Score 24.34
PubTator Score 18.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
astrocytic glioma -1.600 4.3e-03
ependymoma -2.500 2.4e-03
oligodendroglioma -1.500 3.5e-02
glioblastoma -2.000 1.6e-05
cystic fibrosis 1.792 1.7e-06
atypical teratoid / rhabdoid tumor -1.800 2.7e-03
medulloblastoma, large-cell -1.300 4.9e-03
juvenile dermatomyositis 1.649 7.9e-09
intraductal papillary-mucinous adenoma (... -1.100 6.3e-03
intraductal papillary-mucinous carcinoma... -1.700 3.0e-02
intraductal papillary-mucinous neoplasm ... -3.000 2.4e-02
pancreatic cancer -1.200 6.6e-03
interstitial cystitis -1.700 5.6e-05
pediatric high grade glioma -1.600 7.0e-06
sonic hedgehog group medulloblastoma -1.500 3.2e-02
sarcoidosis -1.200 3.5e-04
subependymal giant cell astrocytoma -2.561 3.0e-02
lung adenocarcinoma -1.100 2.1e-02
Breast cancer -2.500 2.2e-08
lung carcinoma 1.300 3.1e-28
breast carcinoma -1.200 8.6e-15
Pick disease -1.300 1.1e-02
acute myeloid leukemia -2.100 1.3e-02
ovarian cancer -2.000 6.1e-05

Synonym

Accession Q9BXY8 B2R574 D3DXA2 F5H7H5 Q5JVV9
Symbols BEX1
DJ79P11.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Pathway (1)

Gene RIF (12)

PMID Text
25490384 Bex2 affects the invasion and migration ability of glioma cells by regulating beta-catenin
23022184 Bex2 may be an important player during the development of glioma
22907646 Bex2 overexpression promoted cell migration and invasion in glioma cell lines.
22698742 Both BEX2 and INI1/hSNF5 mainly localized in cell nucleus.
21384344 BEX2 overexpression was associated with breast cancer.
20482821 BEX2 has a functional interplay with c-Jun and p65/RelA in breast cancer.
19835597 These results suggest that the conspicuous expression of the tumor suppressor genes BEX2, IGSF4 and TIMP3 in MLLmu acute myeloid leukemias cell lines is the consequence of altered epigenetic properties of MLL fusion proteins.
19412433 BEX2 is implicated in oligodendroglioma biology.
17638883 a NGF/BEX2/NF-kappaB pathway is involved in regulating apoptosis in breast cancer cells and in modulating response to tamoxifen in primary tumors
17251904 Correlation between BEX2 expression and mixed lineage leukemia chromosomal aberrations are shown in the cell lines.
16818640 Two novel brain expressed genes, BEX1 and BEX2 are identified; they are silenced in all glioma specimens and exhibit extensive promoter hypermethylation.
16314316 hBex2 may act as a specific regulator during embryonic development by modulating the transcriptional activity of a novel E-box sequence-binding complex that contains hBex2, LMO2, NSCL2 and LDB1.

AA Sequence

MESKEERALNNLIVENVNQENDEKDEKEQVANKGEPLALPLNVSEYCVPRGNRRRFRVRQPILQYRWDIM      1 - 70
HRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP                 71 - 128
//

Text Mined References (22)

PMID Year Title
25490384 2015 ?-catenin is involved in Bex2 down-regulation induced glioma cell invasion/migration inhibition.
25416956 2014 A proteome-scale map of the human interactome network.
23022184 2012 Bex2 regulates cell proliferation and apoptosis in malignant glioma cells via the c-Jun NH2-terminal kinase pathway.
22907646 2013 Bex2 is critical for migration and invasion in malignant glioma cells.
22698742 2012 [BEX2 regulates cell cycle through the interaction with INI1/hSNF5].
21384344 2012 A feedback loop between BEX2 and ErbB2 mediated by c-Jun signaling in breast cancer.
20482821 2010 BEX2 has a functional interplay with c-Jun/JNK and p65/RelA in breast cancer.
19835597 2009 Hypomethylation and expression of BEX2, IGSF4 and TIMP3 indicative of MLL translocations in acute myeloid leukemia.
19711341 2010 BEX2 regulates mitochondrial apoptosis and G1 cell cycle in breast cancer.
19412433 2009 Galectin 1 proangiogenic and promigratory effects in the Hs683 oligodendroglioma model are partly mediated through the control of BEX2 expression.
17638883 2007 BEX2 is overexpressed in a subset of primary breast cancers and mediates nerve growth factor/nuclear factor-kappaB inhibition of apoptosis in breast cancer cell lines.
17251904 2007 Epigenetic regulation of brain expressed X-linked-2, a marker for acute myeloid leukemia with mixed lineage leukemia rearrangements.
16818640 2006 Genome-wide analysis of epigenetic silencing identifies BEX1 and BEX2 as candidate tumor suppressor genes in malignant glioma.
16314316 2005 Human Bex2 interacts with LMO2 and regulates the transcriptional activity of a novel DNA-binding complex.
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15958283 2005 Characterization of the Bex gene family in humans, mice, and rats.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12054873 2002 Olfactory marker protein (OMP) exhibits a beta-clam fold in solution: implications for target peptide interaction and olfactory signal transduction.