Property Summary

NCBI Gene PubMed Count 16
PubMed Score 23.82
PubTator Score 12.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.200 1.7e-03
astrocytic glioma -1.100 1.9e-02
atypical teratoid / rhabdoid tumor -2.200 2.6e-05
Breast cancer -1.700 2.8e-06
colon cancer -3.300 4.1e-08
cystic fibrosis 1.100 6.9e-03
ependymoma -1.600 2.0e-05
glioblastoma -1.800 2.1e-03
intraductal papillary-mucinous adenoma (... -5.200 1.1e-05
intraductal papillary-mucinous carcinoma... -4.000 3.3e-04
intraductal papillary-mucinous neoplasm ... -5.100 6.8e-06
lung adenocarcinoma -1.300 2.4e-06
lung carcinoma 5.200 1.0e-56
malignant mesothelioma -9.200 3.3e-10
osteosarcoma -3.764 2.9e-03
ovarian cancer -3.000 1.9e-08
pancreatic cancer -2.000 1.2e-03
Pick disease -1.700 2.9e-03
primary pancreatic ductal adenocarcinoma -2.115 5.2e-03
tuberculosis -1.400 6.6e-04

Gene RIF (8)

AA Sequence

MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRL      1 - 70
GEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP                    71 - 125
//

Text Mined References (18)

PMID Year Title