Property Summary

NCBI Gene PubMed Count 16
PubMed Score 146.92
PubTator Score 105.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia -1.700 2.2e-02
gastric cancer 1.200 2.1e-03
hepatocellular carcinoma 1.600 2.6e-05
ovarian cancer -1.500 3.5e-05
pancreatic cancer 1.500 3.8e-03
pancreatic carcinoma 1.500 3.8e-03
tuberculosis -1.800 6.1e-06

 GO Function (1)

Protein-protein Interaction (3)

Gene RIF (1)

AA Sequence

MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQ      1 - 70
FDSTTGFLGKTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR                           71 - 118
//

Text Mined References (23)

PMID Year Title