Property Summary

NCBI Gene PubMed Count 9
PubMed Score 24.89
PubTator Score 13.82

Knowledge Summary

Patent (318)

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 3.8e-07
ulcerative colitis 1819 1.1e-05
active Crohn's disease 922 3.8e-02
Disease Target Count Z-score Confidence
Vitelliform macular dystrophy 14 5.131 2.6
Patau syndrome 14 3.159 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
active Crohn's disease -1.291 3.8e-02
ependymoma 2.000 3.8e-07
ulcerative colitis -3.200 1.1e-05

Gene RIF (4)

AA Sequence

MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITYRLLLTQEQRYVYAQVARYCN      1 - 70
RSADLIPLSFVLGFYVTLVVNRWWSQYTSIPLPDQLMCVISASVHGVDQRGRLLRRTLIRYANLASVLVL     71 - 140
RSVSTRVLKRFPTMEHVVDAGFMSQEERKKFESLKSDFNKYWVPCVWFTNLAAQARRDGRIRDDIALCLL    141 - 210
LEELNKYRAKCSMLFHYDWISIPLVYTQVVTIAVYSFFALSLVGRQFVEPEAGAAKPQKLLKPGQEPAPA    211 - 280
LGDPDMYVPLTTLLQFFFYAGWLKVAEQIINPFGEDDDDFETNQLIDRNLQVSLLSVDEMYQNLPPAEKD    281 - 350
QYWDEDQPQPPYTVATAAESLRPSFLGSTFNLRMSDDPEQSLQVEASPGSGRPAPAAQTPLLGRFLGVGA    351 - 420
PSPAISLRNFGRVRGTPRPPHLLRFRAEEGGDPEAAARIEEESAESGDEALEP                     421 - 473
//

Text Mined References (10)

PMID Year Title