Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.58
PubTator Score 0.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia -1.200 2.8e-02
adult high grade glioma -1.600 2.6e-02
astrocytic glioma -1.100 2.1e-02
Astrocytoma, Pilocytic -1.700 1.7e-03
atypical teratoid / rhabdoid tumor -1.800 1.6e-02
ependymoma -1.200 3.7e-02
glioblastoma -1.500 9.3e-03
group 4 medulloblastoma -1.700 1.3e-02
medulloblastoma, large-cell -1.900 3.6e-02
non primary Sjogren syndrome sicca -1.300 1.7e-02
osteosarcoma -1.598 1.6e-02
pituitary cancer -1.900 2.7e-07

Gene RIF (1)

AA Sequence

MEEEMQPAEEGPSVPKIYKQRSPYSVLKTFPSKRPALAKRYERPTLVELPHVRAPPPPPPPFAPHAAVSI      1 - 70
SSSEPPPQQFQAQSSYPPGPGRAAAAASSSSPSCTPATSQGHLRTPAQPPPASPAASSSSSFAAVVRYGP     71 - 140
GAAAAAGTGGTGSDSASLELSAESRMILDAFAQQCSRVLSLLNCGGKLLDSNHSQSMISCVKQEGSSYNE    141 - 210
RQEHCHIGKGVHSQTSDNVDIEMQYMQRKQQTSAFLRVFTDSLQNYLLSGSFPTPNPSSASEYGHLADVD    211 - 280
PLSTSPVHTLGGWTSPATSESHGHPSSSTLPEEEEEEDEEGYCPRCQELEQEVISLQQENEELRRKLESI    281 - 350
PVPCQTVLDYLKMVLQHHNQLLIPQPADQPTEGSKQLLNNYPVYITSKQWDEAVNSSKKDGRRLLRYLIR    351 - 420
FVFTTDELKYSCGLGKRKRSVQSGETGPERRPLDPVKVTCLREFIRMHCTSNPDWWMPSEEQINKVFSDA    421 - 490
VGHARQGRAVGTFLHNGGSFYEGIDHQASQDEVFNKSSQDGSGD                              491 - 534
//

Text Mined References (5)

PMID Year Title