Property Summary

NCBI Gene PubMed Count 317
PubMed Score 1336.30
PubTator Score 834.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.207 3.4e-05
intraductal papillary-mucinous carcinoma... 1.100 1.9e-02
ovarian cancer 1.900 1.0e-03

Gene RIF (275)

PMID Text
27468577 Decreased miR-124-3p expression prompted breast cancer cell progression mainly by enhancing the expression of autophagy related protein, Beclin-1.
27468561 Suggest high expression of Beclin-1 in alveolar macrophages could be a novel biomarker for predicting anti-TB outcomes.
26988033 Beclin-1 role in antiviral immune responses: USP19 modulates antiviral immune responses by deubiquitinating Beclin-1.
26937551 Data suggest that flexible helical domain of BECN1 undergoes a binding-associated disorder-to-helix transition; conserved residues critical for this interaction are essential for autophagy (here, autophagy induced by switching cells to EBSS).
26929373 Both transfected and endogenous beclin 1 coimmunoprecipitated with vGPCR.
26756998 The high levels of beclin-1 observed in hepatitis tissues suggest a central role for autophagy that may limit liver damage and interact with progression to cancer where beclin-1 later on becomes suppressed in aggressive HCC cases.
26739061 Astemizole-histamine induces Beclin-1-independent autophagy by targeting p53-dependent crosstalk between autophagy and apoptosis.
26722036 Autophagy status, as determined by combined LC3, Beclin 1 and p62 expression, might be independently associated with poor survival in patients with gastric cancer.
26708607 Collectively these results indicate miR-30a and its downstream target gene Beclin-1 can be used in treatment of osteosarcoma chemo-resistance in the future.
26617774 Suggest that Beclin 1 and p62 could serve as potential indicators for the prognosis of patients with non-small cell lung cancer.
26573276 The casp3 cleaved product of Beclin1 promotes apoptosis induced by S1 in SKOV3 cells.
26549519 these data indicate that IL-6 inhibits starvation-induced autophagy and that p-STAT3 mediates the signal transduction from IL-6 to downstream proteins including Bcl-2 and Beclin1
26506105 distinct patterns of Beclin 1 and Beclin 2 were associated with aggressive clinical outcomes. Beclin 1 overexpression, as well as Beclin 2 overexpression and depletion, contributed to tumor growth.
26458502 Autophagy defects caused by loss of Beclin 1 are not related to chemoresistance and metastasis, but may be associated with malignant phenotype and poor prognosis of ovarian clear cell carcinoma
26395023 up-regulated expression during the monocyte-to-dendritic cell transition
26386349 in-vitro genetic depletion of beclin-1 in high glucose treated adult rat cardiomyocytes markedly inhibited the level of autophagy and subsequent apoptotic cell death.
26363527 the expressions of Beclin1, Raptor, and Rictor are related to the development and progression of colorectal carcinoma and multidrug resistance.
26330555 HIV-1 Env gp120 treatment of SH-SY5Y cells increases BECN1 which indicates the initiation of autophagosome formation
26319552 Silencing Beclin1 in HTLV-1-transformed T cells resulted in diminished activities of NF-kappaB and Stat3 as well as impaired growth.
26295339 FBG1 degrades A1AT-Z through a Beclin1-dependent arm of autophagy.
26263979 Cleavage of Beclin-1 determines switch to apoptosis since expression of caspase-resistant Beclin-1 inhibits apoptosis and sustains autophagy
26239434 this work makes novel observations about tumor expression of Beclin-1 and challenges the accepted understanding of its role in regulating autophagy in ovarian cancer.
26218645 The decrease in BECN1 degradation induced by SLC9A3R1 resulted in the activity of autophagy stimulation in breast cancer cells
26134156 the results demonstrated that miR216a enhanced the radiosensitivity of pancreatic cancer cells by inhibiting beclin-1-mediated autophagy, suggesting a promising molecular target for improving the radiotherapy of pancreatic cancer
26097572 In colorectal cancer, differentiation degree and lymphatic metastasis were not associated with BECN1. BECN1 expression was significantly higher in cancerous tissue than in adjacent tissue.
26055714 Tid1 increases autophagic flux by interacting with the Beclin 1-containing autophagy protein complex.
26008601 acetylated by p300 and deacetylated by SIRT1 at lysine residues 430 and 437; acetylation inhibits autophagosome maturation
25955014 These results demonstrate the essential role of BECN1 in the functional formation of autophagosomes, but not in LC3B lipidation.
25906440 that ISGylation of BECN1 at Lys117, as well as Lys263, Lys265, and Lys266 serve an important role in negative regulation of intracellular processes including autophagy
25871810 Patients with strong immunoreactivity to BECLIN 1 or LC3 had a significantly better overall survival (OS) than patients with negative to moderate immunoreactivity (p = 0.036 and 0.018, respectively).
25847297 HIV-1 Env gp120 treatment of SH-SY5Y cells increases BECN1 which indicates the initiation of autophagosome formation
25837021 a mechanism of inverse coregulation between BECN1 and MCL1 significantly contributes to their opposing roles in tumorigenesis
25824726 Downregulation of beta 3 -integrin with cRGD peptide resulted in enhanced LC3-II and Beclin-1 and decreased Bcl-2 expression.
25821789 Combined L-EGFR + H-Beclin1 expression may represent a biomarker in identifying relatively favorable clinical presentations and prognosis, thus envisaging possible EGFR/Beclin1-targeted therapies.
25803737 Both AMBRA1 and BECLIN 1 affect c-Myc regulation, but through two different pathways.
25758178 showed a marked effect on the apoptosis of K562 cells by Beclin 1 shRNA to sonodamage with increased DAPI staining and caspase-3 cleavage
25715028 the BH3 mimetic ABT-737 induces autophagy through a BAX and BAK1-independent mechanism that likely involves disruption of BECN1 binding to antiapoptotic BCL2 family members
25714272 FKBP5 associates with BECN1, changes its phosphorylation and protein levels and enhances markers of autophagy and autophagic flux
25714112 cis-unsaturated fatty acids require neither BECN1 nor PIK3C3 to stimulate the autophagic flux
25708267 Beclin 1 may be a predictive biomarker for the efficacy of chemoradiation in patients with rectal cancer.
25693418 findings reveal MK2/MK3 as crucial stress-responsive kinases that promote autophagy through Beclin 1 S90 phosphorylation
25669656 The E3 ubiquitin ligase activity of XIAP and cIAP1 activates NFkappaB signalling, leading to the direct binding of p65 to the promoter of Beclin 1 and to its transcriptional activation and induction of autophagy.
25649430 Results indicated that the expression of NS5ATP9 was up-regulated by starvation and that Beclin 1 was involved in autophagy induced in hepatoblastoma cells by starvation.
25639875 a novel role for beclin 1 in regulating growth factor signaling and reveal a mechanism by which loss of beclin 1 expression would enhance breast cancer progression.
25631043 Tetherin interacts LRPPRC and prevents LRPPRC from forming a ternary complex with Beclin 1 and Bcl-2 so that Beclin 1 is released to bind with PI3KCIII to activate autophagy.
25620738 HBx induces autophagosome formation via beclin-1 expression, whereas miRNA-30a overexpression could successfully inhibit the beclin-1 expression induced by HBx, thereby modulating autophagosome formation in hepatic cells
25607466 TXNDC17, through participation of BECN1, induces autophagy and consequently results in paclitaxel resistance in ovarian cancer
25596085 Our findings that reduced Beclin-1 and high HIF-1alpha expression are associated with the development and progression of HCC may provide molecular therapeutic targets toward inhibiting HCC development and progression.
25565814 Magnetic iron oxide nanoparticles can induce the autophagy in blood cells by regulating the Beclin 1/Bcl-2/Atg14/VPS34 complex.
25496667 HIV-1 Env gp120 treatment of SH-SY5Y cells increases BECN1 which indicates the initiation of autophagosome formation
25472497 Beclin 1 and Mcl-1 negatively modulate the proteasomal degradation of each other through competitive displacement of USP9X. Inverse co-regulation of Beclin 1 and Mcl-1 represents a mechanism of functional counteraction in cancer.
25466963 LC3, beclin-1, and p62, was increased at an early stage of multistep cholangiocarcinogenesis in hepatolithiasis
25439234 HIV-1 Env gp120 treatment of SH-SY5Y cells increases BECN1 which indicates the initiation of autophagosome formation
25436332 Beclin-1 was highly expressed in gallbladder cancer, and positive expression in cancer cells was significantly related with favorable prognosis.
25427639 The results of this study suggest that Beclin-1 plays an important role in proliferation and tumor progression in osteosarcoma and inhibition autophagy can increase the efficacy of anticancer agent therapy.
25400807 Autophagy is implicated in the cisplatin resistant osteosarcoma, and inhibition of beclin1 could be a target for improving osteosarcoma therapy.
25366815 control retrotransposon insertion in the genome
25318890 Data suggest that hypoxia-induced autophagy through c-Jun-mediated Beclin1 expression may be a target to reverse the radioresistance in cancer cells.
25311841 PLP2-TM interacts with the key autophagy regulators, LC3 and Beclin1, and promotes Beclin1 interaction with STING, the key regulator for antiviral IFN signaling, to negatively regulate antiviral innate immunity.
25292086 Over-expression of Beclin-1 facilitates acquired resistance to histone deacetylase inhibitor-induced apoptosis in breast cancer.
25275521 Beclin 1 is required for neuron viability and regulates endosome pathways, including endocytosis and autophagy.
25208472 Therefore, Beclin-1-p53 interaction defines one additional molecular subroutine crucial for cell fate decisions in embryonal carcinoma cells.
25204229 BAG3 induced autophagy is Beclin-1 independent
25196438 It was suggested that Beclin 1 expression is closely linked to colorectal carcinogenesis and distant metastasis of colorectal carcinoma.
25179078 Beclin-1 and its role as a target for anticancer therapy
25175672 Study demonstrated that expression of LKB1 and Beclin1 was reduced in non-small cell lung cancer (NSCLC) tissues, and the reduced expression of these proteins, is an independent indicator for the overall survival of NSCLC patients.
25136588 high level of expression of BECLIN 1 and LC3 in tumours is well correlated with the overall survival of the patients.
25115400 We demonstrate Beclin 1-independent autophagy is involved to positively regulate nutrient deprivation induced-HIF-1alpha internal ribosome entry site activity and protein expression
25096824 results indicate that autophagy regulating gene, Beclin1, may contribute to the malignant phenotypes of TSCC cells and can be a potential target for oral cancer gene therapy
25046113 reveal a novel function of GA binding protein in the regulation of autophagy via transcriptional activation of the BECN1-PIK3C3 complex
25032846 Beclin-1 from cytoplasmic Bcl-2-Beclin-1 complexes and allows it to initiate autophagy.
24971696 There was an inverse correlation between p62 and Beclin-1 levels in primary cells and MM cell lines.
24970676 Tunicamycin increased the misfolded proteins that lead to the activation of endoplasmic reticulum stress-mediated protection and induced apoptosis paralleled by autophagy in breast cancer cells which was regulated by IRE1/JNK/beclin-1.
24969889 Did not found any correlation between Beclin-1 over-expression and tumor differentiation.
24956373 Beclin 1 and UVRAG confer protection against radiation-induced DNA DNA double strand breaks and may maintain centrosome stability in established tumor cells.
24941712 High expression of beclin-1 in papillary thyroid carcinoma and metastatic lymph node suggest that neo-expression of beclin-1 may play a role in tumorigenesis and lymph node metastasis in human papillary thyroid carcinoma.
24885292 Expression of beclin-1 and its autophagic activities are suppressed in some hepatocellular carcinoma tissues.
24760274 our results suggest that the activated Stat3 may represent an important mechanism for Beclin 1 downregulation in nonsmall cell lung cancer development
24755562 Our results indicated that paclitaxel resistance of lung cancer is associated with downregulation of miR-17-5p expression which might cause upregulation of BECN1 expression.
24733562 These findings show that Beclin-1 plays a non-autophagic role in RANKL-induced osteoclastogenesis by inducing the production of reactive oxygen species and NFATc1.
24716949 The alternative splicing of Beclin 1 might play important roles in leukemogenesis.
24690321 Our results suggest an association between bcl-2 and beclin 1 expressions in malignant transformation of prostate tissue
24681041 Altogether, we concluded that miR-216b regulated both autophagy and apoptosis by modulating Beclin 1 in human Tenon's fibroblasts treated with hydroxycamptothecin.
24623173 Beclin-1-overexpressing neuronal cells responded to mechanical injury with greater LC3II/LC3I conversion and cell viability, lower levels of apoptosis, higher Bcl-2 expression, and unaltered Bax expression as compared to vector control cells.
24535641 overexpression of Beclin 1 in U87 glioblastoma cells enhanced the capacity for cellular autophagy and induced apoptosis
24528868 Thus, the cGAS-Beclin-1 interaction shapes innate immune responses by regulating both cGAMP production and autophagy, resulting in well-balanced antimicrobial immune responses.
24478461 Data indicates that BECN1 is not significantly mutated in human cancer and not a tumor-suppressor gene.
24440703 Data indicate that rapamycin significantly enhanced mitophagy, as evidenced by the increase in LC3-II and Beclin-1 expression in the mitochondria and p62 translocation to the mitochondria.
24385262 This review describes a role for beclin 1 in regulating recycling of phagocytic receptors in microglia.
24365867 This study showed a brain-specific reduction in beclin1 expression in postmortem hippocampus of schizophrenia patients
24345332 Binding sequences of miR-30d in the beclin-1-3' untranslated region (UTR) are required for the inhibition of beclin 1 expression by this miRNA.
24324270 Rhes robustly binds the autophagy regulator Beclin-1, decreasing its inhibitory interaction with Bcl-2 independent of JNK-1 signaling.
24324106 Dual expression of tumor Beclin-1 and Atg5 expression may be an adverse prognostic indicator for oral squamous cell carcinoma
24303007 our study demonstrated that Beclin 1low expression, correlated with lymph node metastasis, and might be a negative prognostic biomarker for cholangiocarcinoma.
24260370 Low expression of Beclin 1 showed significantly inferior overall survival.
24188325 In conclusion, hepatitis B virus x protein induces autophagy via activating DAPK in a pathway related to Beclin 1, but not JNK.
24186908 Low level of Beclin1 indicates poor prognosis of renal clear cell carcinoma.
24145555 PRNP interacts with BECN1 to recruit the PIK3C3 complex into lipid rafts and thus activates autophagy in response to Abeta42, defining a novel role of PRNP in the regulation of autophagy.
24141421 results suggest that Mst1 coordinately regulates autophagy and apoptosis by phosphorylating Beclin1 and consequently modulating a three-way interaction among Bcl-2 proteins, Beclin1 and Bax
24132590 aberrant Beclin 1 expression is closely linked to tumorigenesis and differentiation of ovarian carcinoma
24034250 EGFR signaling suppresses autophagy via its interaction with Beclin 1 during normal mitogenic signaling as well as during aberrant cell proliferation in cancer cells.
24012002 Microglia isolated from human Alzheimer's disease (AD) brains show significantly reduced beclin 1
23974797 WASH can suppress Beclin 1 ubiquitination to inactivate Vps34 activity leading to suppression of autophagy.
23943370 Studies indicate a significant association between beclin-1 expression and the differentiation of gastric cancer.
23935917 Beclin-1 and LC3-II are downregulated in hypopharyngeal squamous cell carcinoma patients, and their aberrant expression correlates with poor prognosis.
23880165 esophageal squamous cell carcinoma patients treated with definitive chemoradiation with LC3 and Beclin-1-negative expression had a better overall survival than those with LC3 and Beclin-1-positive tumors
23878393 Atg14 is critical in controlling an autophagy-dependent phosphorylation of beclin-1. We map novel phosphorylation sites to serines 90 and 93 and demonstrate that phosphorylation at these sites is necessary for maximal autophagy.
23877263 ROCK1 acts as a prominent upstream regulator of Beclin1-mediated autophagy and maintains a homeostatic balance between apoptosis and autophagy.
23827971 Beclin 1 regulates autophagy and APP processing in Alzheimer's disease [review]
23812859 Downregulation of Beclin 1 and impairment of autophagy play an important role in a small population of colorectal cancer.
23801739 This study provided evidence that beclin 1 overexpression is able to prevent or partially rescue motor impairments characteristic of this disorder.
23790316 Overexpression of beclin1 induced autophagy and apoptosis in lungs of K-rasLA1 mice.
23787295 Data indicate that high cytoplasmic microtubule-associated protein 1 light chain LC3A, LC3B, Beclin 1 and p62/SQSTM1 expressions were independently linked with the Gleason score.
23737459 decreased parkin solubility impedes parkin-Beclin-1 interaction and amyloid clearance
23722017 Down-regulation of beclin 1 expression and also bcl-2 overexpression seems to play an important role in the progression and aggressiveness of bladder urothelial tumors.
23703612 Findings suggest an association between lapatinib-induced autophagy and the disruption of Her2-Beclin-1 complex.
23686476 Investigated and analyzed the Beclin-1 protein expression and to assess its prognostic significance in tissue of laryngeal squamous cell carcinoma.
23573264 Decreased expression of Beclin 1 was inversely correlated with altered expression of Bcl-xL in ovarian carcinoma cohort and with patient survival.
23525201 The knockdown of BECLIN1 promoted cell growth and decreased apoptosis.
23478334 Beclin-1 acts downstream of the KMN complex to influence the recruitment of outer kinetochore proteins and promotes accurate kinetochore anchoring to the spindle during mitosis.
23444126 demonstrate a modified expression of the apoptotic beclin 1 and Bcl-2 proteins in idiopathic pulmonary fibrosis fibroblasts suggesting the existence of an autophagy/apoptosis system dysfunction
23429496 Data suggest that activated autophagy is associated with the progression of pancreatic ductal adenocarcinoma and that the overexpression of autophagy-related proteins Atg5, Ambra1, beclin-1, LC3B and Bif-1 is significantly correlated with poor outcome.
23427159 HIV-1 Env gp120 treatment of SH-SY5Y cells increases BECN1 which indicates the initiation of autophagosome formation
23420005 Beclin-1 serves not only as a key autophagic regulator with its specific interactors, but as a potential therapeutic target in cancer.
23337876 Overexpression of miR-199a-5p inhibits DRAM1 and Beclin1 expression.
23334926 Beclin 1 was highly expressed in venous invasion and lymph node metastasis in gastric carcinoma.
23316280 The VMP1-Beclin 1 interaction regulates autophagy induction.
23264393 Beclin 1 possesses autophagy-independent antitumoral effects upon exposure of thyroid cancer cells to proteasome inhibitors.
23225331 Loss of beclin1 led to drug resistance in duodenal adenocarcinoma.
23216071 The accelerated autophagic status in non-small cell lung carcinoma is unrelated to Beclin 1 and BNIP3 expression, but does show significant association with Bcl-2 reactivity.
23197835 Anaplasma actively induces autophagy by secreting Ats-1 that hijacks the Beclin 1-Atg14L autophagy initiation pathway likely to acquire host nutrients for its growth
23184933 results suggest that XBP1 mRNA splicing triggers an autophagic signal pathway through transcriptional regulation of BECLIN-1
23125008 Beclin 1 has an influence on the progression of bladder cancer and might serve as a potential prognostic factor for patients with bladder cancer.
23112296 Akt-mediated phosphorylation of Beclin 1 functions in autophagy inhibition, oncogenesis, and the formation of an autophagy-inhibitory Beclin 1/14-3-3/vimentin intermediate filament complex.
23089287 LC3, beclin 1, and GRP78 may play an important role in the tumorigenesis of adenoid cystic carcinoma.
23029344 The expression of Beclin-1 in gastric clinical specimens is higher than those in the adjacent noncancerous tissues.
22933281 interaction between FMDV 2C and host protein Beclin1 could be essential for virus replication
22875631 Results indicated that p38 MAPK may be a key regulator for non-canonical Beclin1-independent autophagy.
22805532 Overexpression of Beclin 1 may influence cisplatin-induced apoptosis by mitochondrial dependent pathway.
22797916 Our findings reveal that Atg14L, previously considered to be solely a Beclin 1-binding autophagy protein, plays a novel role in the late stage of endocytic trafficking in conjunction with Snapin
22742832 Bim inhibits autophagy by interacting with autophagy regulator Beclin 1, an interaction facilitated by LC8.
22733132 Beclin 1 is critical for breast cancer stem-like cells maintenance and tumor development
22674982 Together, these results suggested that hepatitis C virus induces autophagy by upregulating Beclin1 and activates mTOR signaling pathway, which in turn may promote hepatocyte growth.
22650021 Compared with normal pancreatic tissue, pancreatic cancer, Bcl-2 expression was upregulated and Beclin-1 expression was downregulated.
22648564 expression level of both Beclin-1 and LC3 were significantly lower in cervical squamous cancer cells than normal squamous epithelial cells.
22627130 these results demonstrate that down-regulation of Beclin-1 may play an important role in the development and progression of oral cancer possibly by dysregulation of autophagy in tumor cells.
22498477 Bcl-B interacts with the BH3 domain of BECN1 and Bcl-B overexpression reduces autophagy triggered by a variety of pro-autophagic stimuli.
22493499 in Escherichia coli-containing phagosomes of mouse macrophages, Slamf1 interacts with the class III PI3K Vps34 in a complex with Beclin-1 and UVRAG
22393062 Beclin 1 coordinates actin dynamics and membrane phospholipid synthesis to promote efficient apoptotic cell engulfment with Rac1
22392728 Loss of HDAC6 expression in human hepatocellular carcinomas and tumor suppression by HDAC6 occur by way of activation of caspase-independent autophagic cell death through the JNK/Beclin 1 pathway in liver cancer.
22335943 Beclin 1 overexpression can inhibit the proliferation and growth of HeLa cells in vitro and vivo, and promote autophagy and apoptosis of HeLa cells.
22314358 analysis of how the Beclin1 coiled-coil domain interface regulates homodimer and heterodimer formation with Atg14L and UVRAG
22310240 Beclin 1 ECD defines a novel class of membrane-binding domain, with a strong preference for lipid membrane enriched with cardiolipin.
22301112 autophagy is initially activated in response to bile acids, but chronic exposure to bile acids leads to decreased Beclin-1 expression and autophagy resistance
22248718 miR-376b controls autophagy by directly regulating intracellular levels of two key autophagy proteins, ATG4C and BECN1.
22242123 This work offers new information on the mechanisms of action of the adenoviral E1B19K protein as partner of Beclin 1 and positive regulator of autophagy.
22240664 Low expression of Beclin 1, associated with high Bcl-xL, played as an independent biomarker, contributing to a more aggressive cancer cell phenotype and poor prognosis for gastric tumor.
22174682 HIV-1 Env gp120 treatment of SH-SY5Y cells increases BECN1 which indicates the initiation of autophagosome formation
22157765 MicroRNA-30a sensitizes tumor cells to cis-platinum via suppressing beclin 1-mediated autophagy.
22147978 Patients with advanced colorectal cancer and low Beclin-1 expression had a longer disease-free survival than those with high Beclin-1 expression, and patients with low LC3 expression had better response to cetuximab.
22095667 Our findings provide a basis for the concept that decreased expression of Beclin 1 in gastric carcinoma (GC) may be an independent biomarker for poor prognosis of patients with GC.
22039439 High levels of Beclin1 mRNA levels were in liver and prostate cancers when compared to normal tissues
21962518 Study provides a molecular mechanism involving protein deubiquitination that connects two important tumor suppressors, p53 and Beclin1.
21936852 This present study described a regulatory link between Beclin 1 and the ubiquitin ligase Nedd4.
21875280 The present results suggest that Beclin1 inhibits invasion and metastasis of cervical cancer CaSki cells in vitro.
21873141 Our results indicate that BECN 1 and autophagy play an important role in controlling the development and progression of cutaneous SCC.
21861179 Data suggest that the joint detection of these three genes (Beclin1, Bcl-2, and Bax) contributes to the early diagnosis of and predicts prognosis for breast cancer.
21779982 Data suggest that the combined detection of p33ING1, p53, and Beclin1 genes and proteins will be helpful for early diagnosis and prognosis judgment for NSCLC, and can provide experimental evidence for biotherapy of NSCLC.
21777947 A progressively reduced Beclin-1 expression is correlated with the primary tumor growth of squamous cell carcinoma and adenocarcinoma of the lung.
21769915 results suggest that autophagy activated by hypoxia mediates the tolerance of hepatocellular carcinoma cells to nutrient deprivation, and this tolerance is dependent on the activity of Beclin 1
21750416 cAMP induces autophagy via a novel pathway involving ERK, cyclin E and Beclin 1
21729531 Up-regulation of autophagic activity and expression of Beclin1 and MAPLC3 mRNA in refractory or relapse acute leukemia patients is especially significant.
21722286 These findings suggest that toxin sensitivity correlates with caspase and calpain activation, leading to Atg5 and Beclin-1 cleavage.
21711108 Beclin1/PI3K-mediated autophagy prevents hypoxia-induced apoptosis in EAhy926 cell line
21681342 Inhibiting Beclin 1 expression increased the apoptotic rate in U251 cells under oxidative stress.
21654208 Beclin 1 has a role in intrahepatic cholangiocellular carcinoma
21646862 Beclin 1-independent autophagy is an important contributor to both the caspase-dependent and -independent components of neuronal apoptosis and may be considered as an important therapeutic target in neural conditions involving apoptosis
21610315 Beclin 1 cleaving has a role in suppressing autophagy in chemotherapy-induced apoptosis
21556768 Both mRNA and protein levels of Beclin-1 and LC3-II were significantly decreased in lung cancer tissues which suggested that autophagy may be involved in the pathogenesis of lung cancer.
21537144 High beclin 1 and LC3A reactivity was related to tumor hypoxia, as this was inferred from the intense expression of HIF1alpha and lactate dehydrogenase 5, whereas low beclin 1 and LC3A expression was linked with an increased vascular density.
21499230 There is a strong association between extensive BECN1 overexpression and early metastases/poor prognosis in uveal melanomas
21478185 The data of this study demonstrated that autophagy is a key degradation pathway, with beclin-1 playing a significant role in alleviating Machado-Joseph disease pathogenesis.
21444671 autophagy is inhibited during chemotherapy-induced apoptosis by caspase 8-mediated cleavage of Beclin 1 after cytochrome c release
21420796 Increased beclin-1 expression plays a role in the inhibition of pancreatic ductal adenocarcinoma progression.
21353614 Ras-induced expression of Noxa and Beclin-1 promotes autophagic cell death, which represents a mechanism to limit the oncogenic potential of deregulated Ras signals.
21327823 Low Beclin 1 expression is associated with chondrosarcoma.
21239722 Normal lymphocyte development involves beclin 1-dependent, early-stage and distinct, beclin 1-independent, late-stage processes.
21209283 NLRP4 is recruited to and accumulates in bacteria-containing phagosomes and transiently dissociates from beclin1 following group A streptococcus infection, thereby sensing infection and permitting the initiation of beclin1-mediated autophagic responses.
21203962 The cleavage of Beclin 1 by caspase-3 may contribute to inactivate autophagy leading towards augmented apoptosis.
21081164 Beclin-1 is depleted in Alzheimer's disease brain following caspase-3 cleavage.
20937944 Beclin 1 is a protein involved in the regulation of autophagy and has been shown to be reduced in patients with Alzheimer disease.
20863706 The progression of astrocytic tumors was related to a decrease in autophagic capacity represented by the loss of LC3B-II and Beclin 1 expression
20842118 Loss of Beclin 1 expression defines poor prognosis presumably by promoting anti-apoptotic pathways, while overexpression of the protein, being linked with tumour hypoxia and acidity, also defines subgroups of tumours with aggressive clinical behaviour.
20697744 Observational study of gene-disease association. (HuGE Navigator)
20643123 A specific sub-complex containing VPS15, VPS34, Beclin 1, UVRAG and BIF-1 regulates both receptor degradation and cytokinesis, whereas ATG14L, a PI3K-III subunit involved in autophagy, is not required.
20639699 Beclin1 expression is predictive of prognosis in extranodal natural killer T-cell lymphoma.
20638385 knock-down of Beclin 1 down-regulated survivin protein, and the turnover rate of survivin was increased when Beclin 1 expression was silenced
20559548 findings suggest that autophagy and the BECN1-PIK3C3 complex regulate amyloid precursor protein processing and play an important role in Alzheimer disease pathology
20473282 This is the first demonstration of the involvement of beclin-1 and autophagy in the clinical behaviour of non-Hodgkin lymphomas
20454448 novel role for 14-3-3tau in the regulation of Beclin 1 expression and autophagy
20368806 engages both autophagic and apoptotic machineries via ROS production and subsequent activation of ERK and JNK
20230646 LOH and aberrant DNA methylation might be the possible reasons of the decreased expression of beclin 1 in the breast tumors. The findings shed some new light on the regulatory mechanisms of beclin 1 in breast cancer.
20207475 results suggest that Beclin1 plays an important role in the regulation of potent anti-tumor activity, and over-expression of Beclin1 in CaSki cells may enhance apoptosis signaling induced by anti-cancer drugs.
20206246 The findings provide evidence for beclin-1 expression in normal bladder; large alterations in the expression of beclin-1 do not occur when urothelial cells are malignantly transformed with, or exposed to, either Cd(2+) or As(3+.).
20190558 Data reveal that Beclin 1 and ATG5 play key roles in morphine-induced autophagy, which may contribute to morphine-induced neuronal injury.
20150769 Data suggest that HIF-1alpha-associated Beclin 1 high expression might facilitate nasopharyngeal carcinoma cells surviving from chemoradiotherapy, suggesting a novel therapeutic molecular target for NPC.
20090905 unlike Bcl-2, Bcl-xL and Atg7 manipulation gave identical phenotypes suggesting they could be components of the same signalling pathway; Bcl-xL subcellular localisation was modified upon starvation, and importantly Bcl-xL acted independently of Beclin 1
20037818 Expression of Beclin1 mRNA in osteosarcoma cells treated with high-dose DDP was higher than that in the non-treated cells.
20023428 Interplay between Beclin 1 and Bcl-2 is required for both autophagy and apoptosis modulation.
20010695 NAF-1 is required in this pathway for BCL-2 at the ER to functionally antagonize Beclin 1-dependent autophagy.
20009549 Targeting Beclin 1 for viral subversion of macroautophagy.
20004946 beclin 1 and LC3 II autophagic gene expression is altered also in melanocytic neoplasms.
19921231 Beclin 1 mRNA and protein expression were significantly decreased in eutopic endometria of women with adenomyosis.
19798108 Results indicate that Coxiella burnetii infection modulates autophagy and apoptotic pathways through Beclin 1/Bcl-2 interplay to establish a successful infection in the host cell.
19778902 Oncogenic ras-induced down-regulation of autophagy mediator Beclin-1 is required for malignant transformation of intestinal epithelial cells.
19762066 Beclin-1 may play a role in the inhibition of the development of breast cancer and its inhibition might be due to an interaction with bcl-2 protein.
19713971 The cleavage of Beclin 1 is a critical event whereby caspases inhibit autophagy, as a non-cleavable Beclin 1 mutant restored autophagy in cells overexpressing Bax
19680556 Observational study of gene-disease association. (HuGE Navigator)
19641499 The BH3 domain of Beclin 1 serves as a key structural motif that enables Bcl-2 to function not only as an antiapoptotic protein, but also as an antiautophagy protein. Review.
19635843 HIV-1 Env gp120 treatment of SH-SY5Y cells increases BECN1 which indicates the initiation of autophagosome formation
19556884 Results describe the prognostic role of high Beclin 1 protein expression and survival in high-grade gliomas.
19535919 Beclin 1 is a potential target for miRNA miR-30a.
19535901 When Beclin 1 binds to Bcl-2, it fails to inhibit Bcl-2-mediated protection against four different inducers of apoptosis.
19520853 the AMPK-MEK/ERK-TSC-mTOR pathway regulation of Beclin 1 represents different thresholds responsible for a protective or destructive autophagy
19395874 DAPk phosphorylates Beclin 1 on T119, a critical residue within its BH3 domain, and thus promotes Beclin 1 dissociation from Bcl-X(L) and autophagy induction.
19375507 Data show that silencing of ATG5 or beclin-1 reduced autophagy in 17alpha-AED treated malignant gliomas and attenuated its cytotoxic effects.
19372752 Barkor competes with UV radiation resistance associated gene product (UVRAG) for interaction with Beclin 1, and orients Beclin 1 to autophagosomes.
19347031 although Beclin-1 contains a BH3-only motif typical of pro-apoptotic proteins, it is a negligible modulator of Bcl-2's anti-apoptotic function
19325567 These results identify IP(3)R as a new regulator of the Beclin 1 complex that may bridge signals converging on the ER and initial phagophore formation.
19318089 JNK activation essential for the autophagic cell death resulted in upregulation of Beclin-1 expression, Bcl-2 phosphorylation, and p53 phosphorylation, suggesting that these pro-autophagic signaling pathways are involved in the autophagic cell death.
19298604 demonstrated that HAb18G/CD147 down-regulated the expression of autophagy-regulating protein Beclin 1 in SMMC7721 cells
19298526 Endostatin induces autophagy in endothelial cells by modulating Beclin 1 and beta-catenin levels
19289499 Data show that p65/RelA upregulates beclin 1 mRNA and protein levels in different cellular systems, and that upregulation of BECN1 is coupled to increased autophagy.
19270696 Two Beclin 1 associated proteins, Atg14L and Rubicon, were identified.
19218137 The abnormal expression of Beclin1 is closely associated with the pathogenesis and development of primary hepatocellular carcinoma.
19180116 Data show that DAPK phosphorylates beclin 1 on Thr 119 located at a crucial position within its BH3 domain, and thus promotes the dissociation of beclin 1 from Bcl-XL and the induction of autophagy.
19145109 Beclin 1-dependent apoptotic activity has a role in preventing progression of hepatocellular carcinoma
19130303 beclin-1 and HIF-1alpha expression are important determinants of survival in esophageal squamous cell carcinoma
19066461 beclin 1 has a role in favorable prognosis in stage IIIB colon cancers
19060920 activation of JNK pathway can mediate Beclin 1 expression, which plays a key role in autophagic cell death in cancer cells
19050071 study defines a regulatory signaling pathway mediated by Barkor (KIAA0831) that positively controls autophagy through Beclin 1
18843052 These results suggest that mammalian cells have at least two distinct class III PI3-kinase complexes, and that beclin 1 interacts distinctly with mammalian Atg14 and UVRAG in two of these complexes.
18829541 Beclin 1 can down-regulate estrogenic signaling and growth response, and contribute to the development of antiestrogen resistance.
18797192 gamma-Herpesvirus protein M11 inhibits autophagy through a mechanism that involves the binding of the Beclin 1 BH3 domain in the M11 hydrophobic surface groove.
18769161 These results demonstrate that Beclin 1 is essential for autophagy, differentiation and antiapoptosis, and may play an important role in coordinating inputs for cellular decisions to signaling machinery that mediates different cellular cascades.
18641390 Bcl-xL and UVRAG cause a monomer-dimer switch in Beclin1
18628207 beclin 1 has a role in vitamin D3-induced autophagy of human myeloid leukemia cells
18552835 Data suggest that a Beclin1-binding autophagic tumour suppressor, UVRAG, interacts with the class C Vps complex, a key component of the endosomal fusion machinery.
18497889 beclin 1 deficiency disrupts neuronal autophagy, modulates APP metabolism, and promotes neurodegeneration
18497881 Abeta pathology is regulated by beclin 1 through a pathway that involves autophagy
18184459 The positive rates of Beclin1 and MAPLC3 were significantly lower in non-small cell lung cancer tissues than in adjacent non-cancerous tissues and normal tissues.
18184403 beclin-1 inactivation by loss of expression may not occur in colorectal and gastric cancers
18005679 Data suggest that ICP34.5-mediated antagonism of the autophagy function of Beclin 1 is essential for viral neurovirulence, and the antiviral signaling molecule PKR lies genetically upstream of Beclin 1 in host defense against HSV-1.
17999086 Data suggest that beclin 1 plays important roles in the regulation of the life span of human CL and ovarian androgen-secreting cells, by maintaining autophagy at levels promoting cell survival rather than cell death.
17786023 Autophagy also plays an essential role in tumorigenesis, as the essential autophagy regulator BECN1 is monoallelically deleted.
17659302 Analysis of all known Bcl-xL/BH3 domain complexes.
17643073 Differential interactions between BECN1 and Bcl-2 family members are reported.
17595761 These results indicate that Beclin 1 can inhibit the growth of colorectal cancer cells.
17550384 this is the first report on BECN1 gene mutations in human cancer tissues, and the data suggest that point mutations are a rare event in common human cancers and probably do not play a major role in cancer pathogenesis
17446862 The functional and physical interaction between Bcl-X(L) and a BH3-like domain in BECN1 was studied.
17441338 Beclin 1 expression is down-regulated in epithelial ovarian cancer tissue while the p110alpha, hvps34 and p-PKB are having the abnormal expressions on PI3K/PKB signaling pathway.
17441324 The constructed vector significantly inhibited the expression of the mRNA and protein of Beclin 1 in the HeLa cells.
17438366 BH3-only proteins and BH3 mimetics induce autophagy by competitively disrupting the interaction between BECN1 and Bcl-2/Bcl-X(L).
17355787 Beclin1 expression is down-regulated in epithelial ovarian cancer tissues, and overexpression can inhibit proliferation and induce apoptosis of SKOV3 cells.
17272502 Kringle 5 of human plasminogen has a role in autophagic survival by up-regulating Beclin 1 and complexing Bcl-2 to Beclin 1
17236580 Expression of autophagy gene Beclin 1 decreases in cervical aquamous cell carcinoma.
17203225 Beclin 1 has different roles in different histotypes of human brain tumours
16874027 Evolutionarily conserved domain of Beclin 1 is essential for Vps34 interaction, autophagy function, and tumor suppressor function.
16718815 Partial Beclin 1 silencing aggravates mitochondrial permeabilization and apoptosis in HepG2 cells treated with an anti-Fas antibody or with doxorubicin
16522639 age-dependent decrease of beclin 1 expression may lead to a reduction of autophagic activity during aging, which in turn promotes the accumulation of mutant Htt and the progression of the disease
16390869 Results argue against a role for Beclin 1 as an essential chaperone or adaptor for hVps34 in normal vesicular trafficking, and they support the hypothesis that Beclin 1 functions mainly to engage hVps34 in the autophagic pathway.
16267277 VPS30/ATG6 complemented A1PiZ degradation-deficient (add3) yeast mutants
15922724 BECLIN 1 augmented cisplatin-induced apoptosis via enhancing caspase 9 activity.
14970205 C(2)-ceramide stimulated macroautophagy in colon cancer cells, stimulated the expression of the autophagy gene product beclin 1, and mediated tamoxifen-dependent accumulation of autophagic vacuoles in breast cancer MCF-7 cells
14966907 expression of three (Beclin 1, RbAp48 and Pir51) were increased and one (aldolase b) was decreased in liver tumor tissues.

AA Sequence

MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFI      1 - 70
ETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEEC     71 - 140
TDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAE    141 - 210
NLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSG    211 - 280
QFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELP    281 - 350
LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN    351 - 420
SEEQWTKALKFMLTNLKWGLAWVSSQFYNK                                            421 - 450
//

Text Mined References (325)

PMID Year Title
27468577 2016 Decreased miR-124-3p Expression Prompted Breast Cancer Cell Progression Mainly by Targeting Beclin-1.
27468561 2016 High Beclin-1 Expression in Human Alveolar Macrophage Significantly Correlate with the Bacteriologic Sterilization in Pulmonary Tuberculosis Patients.
26988033 2016 USP19 modulates autophagy and antiviral immune responses by deubiquitinating Beclin-1.
26937551 2016 Conformational Flexibility Enables the Function of a BECN1 Region Essential for Starvation-Mediated Autophagy.
26929373 2016 Endolysosomal trafficking of viral G protein-coupled receptor functions in innate immunity and control of viral oncogenesis.
26756998 2016 Expression of Beclin-1, an autophagy-related marker, in chronic hepatitis and hepatocellular carcinoma and its relation with apoptotic markers.
26739061 2016 Astemizole-Histamine induces Beclin-1-independent autophagy by targeting p53-dependent crosstalk between autophagy and apoptosis.
26722036 2016 Clinicopathological Correlations of Autophagy-related Proteins LC3, Beclin 1 and p62 in Gastric Cancer.
26708607 2016 MicroRNA-30a downregulation contributes to chemoresistance of osteosarcoma cells through activating Beclin-1-mediated autophagy.
26617774 2015 Beclin 1 and p62 expression in non-small cell lung cancer: relation with malignant behaviors and clinical outcome.
26573276 2016 Caspase-mediated cleavage of Beclin1 inhibits autophagy and promotes apoptosis induced by S1 in human ovarian cancer SKOV3 cells.
26549519 2015 IL-6 Inhibits Starvation-induced Autophagy via the STAT3/Bcl-2 Signaling Pathway.
26506105 2015 Expression of Beclin Family Proteins Is Associated with Tumor Progression in Oral Cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26458502 2015 Loss of autophagy-related protein Beclin 1 may define poor prognosis in ovarian clear cell carcinomas.
26395023 2015 IL-10 restricts dendritic cell (DC) growth at the monocyte-to-monocyte-derived DC interface by disrupting anti-apoptotic and cytoprotective autophagic molecular machinery.
26386349 2016 Type-2 diabetes increases autophagy in the human heart through promotion of Beclin-1 mediated pathway.
26363527 2015 Autophagy-related genes Raptor, Rictor, and Beclin1 expression and relationship with multidrug resistance in colorectal carcinoma.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26319552 2015 The autophagy molecule Beclin 1 maintains persistent activity of NF-?B and Stat3 in HTLV-1-transformed T lymphocytes.
26295339 2015 FBG1 Is the Final Arbitrator of A1AT-Z Degradation.
26263979 2015 RNase L Cleavage Products Promote Switch from Autophagy to Apoptosis by Caspase-Mediated Cleavage of Beclin-1.
26239434 2015 Beclin-1 expression is retained in high-grade serous ovarian cancer yet is not essential for autophagy induction in vitro.
26218645 2015 SLC9A3R1 stimulates autophagy via BECN1 stabilization in breast cancer cells.
26134156 2015 MicroRNA-216a enhances the radiosensitivity of pancreatic cancer cells by inhibiting beclin-1-mediated autophagy.
26097572 2015 Expression and clinical significances of Beclin1, LC3 and mTOR in colorectal cancer.
26055714 2015 Tid1, the Mammalian Homologue of Drosophila Tumor Suppressor Tid56, Mediates Macroautophagy by Interacting with Beclin1-containing Autophagy Protein Complex.
26008601 2015 Acetylation of Beclin 1 inhibits autophagosome maturation and promotes tumour growth.
25955014 2015 Divergent roles of BECN1 in LC3 lipidation and autophagosomal function.
25906440 2015 Modification of BECN1 by ISG15 plays a crucial role in autophagy regulation by type I IFN/interferon.
25871810 2015 Autophagic Markers BECLIN 1 and LC3 are Associated with Prognosis of Multiple Myeloma.
25837021 2015 A novel autophagy-independent, oncosuppressive function of BECN1: Degradation of MCL1.
25824726 2015 ß3-integrin inhibits lipopolysaccharide-induced autophagy in cardiomyocytes via the Akt signaling pathway.
25821789 2015 Combined epidermal growth factor receptor and Beclin1 autophagic protein expression analysis identifies different clinical presentations, responses to chemo- and radiotherapy, and prognosis in glioblastoma.
25803737 2015 AMBRA1 and BECLIN 1 interplay in the crosstalk between autophagy and cell proliferation.
25758178 2015 The role of Beclin 1 in SDT-induced apoptosis and autophagy in human leukemia cells.
25715028 2015 BAX and BAK1 are dispensable for ABT-737-induced dissociation of the BCL2-BECN1 complex and autophagy.
25714272 2015 FKBP5/FKBP51 enhances autophagy to synergize with antidepressant action.
25714112 2015 Novel inducers of BECN1-independent autophagy: cis-unsaturated fatty acids.
25708267 2015 Association of beclin 1 expression with response to neoadjuvant chemoradiation therapy in patients with locally advanced rectal carcinoma.
25693418 2015 The stress-responsive kinases MAPKAPK2/MAPKAPK3 activate starvation-induced autophagy through Beclin 1 phosphorylation.
25689150 2015 Autophagy modulates the effects of bis-anthracycline WP631 on p53-deficient prostate cancer cells.
25669656 2015 XIAP and cIAP1 amplifications induce Beclin 1-dependent autophagy through NF?B activation.
25649430 2015 NS5ATP9 Promotes Beclin 1-Dependent Starvation-Induced Autophagy of Hepatoblastoma Cells.
25639875 2015 Beclin 1 regulates growth factor receptor signaling in breast cancer.
25631043 2015 The viral restriction factor tetherin prevents leucine-rich pentatricopeptide repeat-containing protein (LRPPRC) from association with beclin 1 and B-cell CLL/lymphoma 2 (Bcl-2) and enhances autophagy and mitophagy.
25620738 2015 Overexpression of microRNA-30a inhibits hepatitis B virus X protein-induced autophagosome formation in hepatic cells.
25607466 2015 TXNDC17 promotes paclitaxel resistance via inducing autophagy in ovarian cancer.
25596085 2015 Defective Beclin-1 and elevated hypoxia-inducible factor (HIF)-1? expression are closely linked to tumorigenesis, differentiation, and progression of hepatocellular carcinoma.
25594178 2015 A kinase-independent role for EGF receptor in autophagy initiation.
25565814 2015 Ferroferric oxide nanoparticles induce prosurvival autophagy in human blood cells by modulating the Beclin 1/Bcl-2/VPS34 complex.
25490155 2014 Architecture and dynamics of the autophagic phosphatidylinositol 3-kinase complex.
25472497 2014 Beclin 1 restrains tumorigenesis through Mcl-1 destabilization in an autophagy-independent reciprocal manner.
25466963 2015 Autophagy may occur at an early stage of cholangiocarcinogenesis via biliary intraepithelial neoplasia.
25436332 2014 Clinicopathologic correlation of autophagy-related Beclin-1 expression in gallbladder cancer.
25427639 2015 Knockdown of autophagy-related protein 6, Beclin-1, decreases cell growth, invasion, and metastasis and has a positive effect on chemotherapy-induced cytotoxicity in osteosarcoma cells.
25400807 2014 Inhibition of beclin1 affects the chemotherapeutic sensitivity of osteosarcoma.
25366815 2014 Autophagy supports genomic stability by degrading retrotransposon RNA.
25318890 2014 Hypoxia-induced autophagy contributes to radioresistance via c-Jun-mediated Beclin1 expression in lung cancer cells.
25311841 2014 Coronavirus membrane-associated papain-like proteases induce autophagy through interacting with Beclin1 to negatively regulate antiviral innate immunity.
25292086 2014 Over-expression of Beclin-1 facilitates acquired resistance to histone deacetylase inhibitor-induced apoptosis.
25275521 2014 Beclin 1 is required for neuron viability and regulates endosome pathways via the UVRAG-VPS34 complex.
25215947 2015 AMBRA1 is able to induce mitophagy via LC3 binding, regardless of PARKIN and p62/SQSTM1.
25208472 2014 Beclin-1-p53 interaction is crucial for cell fate determination in embryonal carcinoma cells.
25204229 2015 WW domain of BAG3 is required for the induction of autophagy in glioma cells.
25196438 2014 Beclin 1 expression is closely linked to colorectal carcinogenesis and distant metastasis of colorectal carcinoma.
25179078 2014 Beclin-1 and its role as a target for anticancer therapy.
25175672 2014 Reduced expression of liver kinase B1 and Beclin1 is associated with the poor survival of patients with non-small cell lung cancer.
25136588 2014 Expression and clinical significance of the autophagy proteins BECLIN 1 and LC3 in ovarian cancer.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
25115400 2014 Beclin-1-independent autophagy positively regulates internal ribosomal entry site-dependent translation of hypoxia-inducible factor 1? under nutrient deprivation.
25096824 2014 Beclin1 inhibits proliferation, migration and invasion in tongue squamous cell carcinoma cell lines.
25046113 2014 GA binding protein augments autophagy via transcriptional activation of BECN1-PIK3C3 complex genes.
25032846 2014 CHOP mediates ASPP2-induced autophagic apoptosis in hepatoma cells by releasing Beclin-1 from Bcl-2 and inducing nuclear translocation of Bcl-2.
24971696 2014 An imbalance between Beclin-1 and p62 expression promotes the proliferation of myeloma cells through autophagy regulation.
24970676 2014 Connecting endoplasmic reticulum stress to autophagy through IRE1/JNK/beclin-1 in breast cancer cells.
24969889 2014 Prognostic significance of Beclin-1 expression in colorectal cancer: a meta-analysis.
24956373 2014 Beclin 1 and UVRAG confer protection from radiation-induced DNA damage and maintain centrosome stability in colorectal cancer cells.
24941712 Beclin 1 is highly expressed in papillary thyroid carcinoma and correlates with lymph node metastasis.
24885292 2014 The expression of beclin-1, an autophagic gene, in hepatocellular carcinoma associated with clinical pathological and prognostic significance.
24785657 2014 NRBF2 regulates macroautophagy as a component of Vps34 Complex I.
24760274 2014 Stat3 inhibits Beclin 1 expression through recruitment of HDAC3 in nonsmall cell lung cancer cells.
24755562 2014 miR-17-5p downregulation contributes to paclitaxel resistance of lung cancer cells through altering beclin1 expression.
24733562 2014 Beclin-1 is required for RANKL-induced osteoclast differentiation.
24716949 2014 Alternative messenger RNA splicing of autophagic gene Beclin 1 in human B-cell acute lymphoblastic leukemia cells.
24690321 2014 The relation of beclin 1 and bcl-2 expressions in high grade prostatic intraepithelial neoplasia and prostate adenocarcinoma: a tissue microarray study.
24681041 2014 MicroRNA-216b/Beclin 1 axis regulates autophagy and apoptosis in human Tenon's capsule fibroblasts upon hydroxycamptothecin exposure.
24623173 2014 Beclin-1-mediated autophagy protects spinal cord neurons against mechanical injury-induced apoptosis.
24535641 2014 Beclin 1, an autophagy-related gene, augments apoptosis in U87 glioblastoma cells.
24528868 2014 Crosstalk between the cGAS DNA sensor and Beclin-1 autophagy protein shapes innate antimicrobial immune responses.
24478461 2014 Mutational landscape of the essential autophagy gene BECN1 in human cancers.
24472739 2014 Decorin activates AMPK, an energy sensor kinase, to induce autophagy in endothelial cells.
24443581 2014 Targeting ?-herpesvirus 68 Bcl-2-mediated down-regulation of autophagy.
24440703 2014 Rapamycin attenuates mitochondrial dysfunction via activation of mitophagy in experimental ischemic stroke.
24385262 2014 Sorting through the roles of beclin 1 in microglia and neurodegeneration.
24365867 2015 Autophagy has a key role in the pathophysiology of schizophrenia.
24349490 2013 Rab39a interacts with phosphatidylinositol 3-kinase and negatively regulates autophagy induced by lipopolysaccharide stimulation in macrophages.
24345332 2014 Regulation of autophagy by miR-30d impacts sensitivity of anaplastic thyroid carcinoma to cisplatin.
24324270 2014 Rhes, a striatal-selective protein implicated in Huntington disease, binds beclin-1 and activates autophagy.
24324106 2013 Immunopositivity of Beclin-1 and ATG5 as indicators of survival and disease recurrence in oral squamous cell carcinoma.
24303007 2013 Beclin 1 deficiency correlated with lymph node metastasis, predicts a distinct outcome in intrahepatic and extrahepatic cholangiocarcinoma.
24260370 2013 Autophagic protein Beclin 1 serves as an independent positive prognostic biomarker for non-small cell lung cancer.
24188325 2014 Hepatitis B virus x protein induces autophagy via activating death-associated protein kinase.
24186908 2013 Lower mRNA and protein expression levels of LC3 and Beclin1, markers of autophagy, were correlated with progression of renal clear cell carcinoma.
24145555 2013 BECN1/Beclin 1 is recruited into lipid rafts by prion to activate autophagy in response to amyloid ? 42.
24141421 2013 Mst1 inhibits autophagy by promoting the interaction between Beclin1 and Bcl-2.
24132590 2014 Aberrant Beclin 1 expression is closely linked to carcinogenesis, differentiation, progression, and prognosis of ovarian epithelial carcinoma.
24113155 2013 Placental autophagy regulation by the BOK-MCL1 rheostat.
24056303 2013 PtdIns(3)P-bound UVRAG coordinates Golgi-ER retrograde and Atg9 transport by differential interactions with the ER tether and the beclin 1 complex.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
24034250 2013 EGFR-mediated Beclin 1 phosphorylation in autophagy suppression, tumor progression, and tumor chemoresistance.
24012002 2013 Microglial beclin 1 regulates retromer trafficking and phagocytosis and is impaired in Alzheimer's disease.
23974797 2013 WASH inhibits autophagy through suppression of Beclin 1 ubiquitination.
23954414 2013 Beclin 2 functions in autophagy, degradation of G protein-coupled receptors, and metabolism.
23943370 2013 The role of beclin-1 expression in patients with gastric cancer: a meta-analysis.
23935917 2013 Aberrant expression of Beclin-1 and LC3 correlates with poor prognosis of human hypopharyngeal squamous cell carcinoma.
23880165 2013 Autophagy-related proteins LC3 and Beclin-1 impact the efficacy of chemoradiation on esophageal squamous cell carcinoma.
23878393 2013 Role of membrane association and Atg14-dependent phosphorylation in beclin-1-mediated autophagy.
23877263 2013 Identification of ROCK1 kinase as a critical regulator of Beclin1-mediated autophagy during metabolic stress.
23827971 Impaired autophagy and APP processing in Alzheimer's disease: The potential role of Beclin 1 interactome.
23812859 2013 Downregulation of Beclin 1 and impairment of autophagy in a small population of colorectal cancer.
23801739 2013 Beclin 1 mitigates motor and neuropathological deficits in genetic mouse models of Machado-Joseph disease.
23790316 2013 Overexpression of beclin1 induced autophagy and apoptosis in lungs of K-rasLA1 mice.
23787295 2014 Autophagy proteins in prostate cancer: relation with anaerobic metabolism and Gleason score.
23737459 2013 Tyrosine kinase inhibition increases functional parkin-Beclin-1 interaction and enhances amyloid clearance and cognitive performance.
23722017 2013 Beclin 1 and bcl-2 expressions in bladder urothelial tumors and their association with clinicopathological parameters.
23703612 2013 Interaction between Her2 and Beclin-1 proteins underlies a new mechanism of reciprocal regulation.
23686476 2013 Prognostic significance of Beclin-1 expression in laryngeal squamous cell carcinoma.
23573264 2013 Decreased expression of Beclin 1 correlates closely with Bcl-xL expression and poor prognosis of ovarian carcinoma.
23541952 2013 Control of autophagic cell death by caspase-10 in multiple myeloma.
23525201 2013 Knockdown of autophagy-related gene BECLIN1 promotes cell growth and inhibits apoptosis in the A549 human lung cancer cell line.
23478334 2013 Beclin-1 is required for chromosome congression and proper outer kinetochore assembly.
23444126 2013 Decreased expression of autophagic beclin 1 protein in idiopathic pulmonary fibrosis fibroblasts.
23429496 2013 Prognostic significance of autophagy-related protein expression in resected pancreatic ductal adenocarcinoma.
23420005 2013 Beclin-1: autophagic regulator and therapeutic target in cancer.
23337876 2013 Differential roles of miR-199a-5p in radiation-induced autophagy in breast cancer cells.
23334926 2013 Beclin 1 expression is an independent prognostic factor for gastric carcinomas.
23332761 2013 Differential regulation of distinct Vps34 complexes by AMPK in nutrient stress and autophagy.
23316280 2013 The VMP1-Beclin 1 interaction regulates autophagy induction.
23264393 2013 Beclin 1 enhances proteasome inhibition-mediated cytotoxicity of thyroid cancer cells in macroautophagy-independent manner.
23225331 2013 Beclin 1 activation enhances chemosensitivity and predicts a favorable outcome for primary duodenal adenocarcinoma.
23216071 2013 Autophagy and Bcl-2/BNIP3 death regulatory pathway in non-small cell lung carcinomas.
23197835 2012 Autophagosomes induced by a bacterial Beclin 1 binding protein facilitate obligatory intracellular infection.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184933 2013 XBP1 mRNA splicing triggers an autophagic response in endothelial cells through BECLIN-1 transcriptional activation.
23182941 2013 A novel ER-localized transmembrane protein, EMC6, interacts with RAB5A and regulates cell autophagy.
23125008 2013 Expression of beclin 1 in bladder cancer and its clinical significance.
23112296 2012 Akt-mediated regulation of autophagy and tumorigenesis through Beclin 1 phosphorylation.
23089287 2012 Expression of autophagy and ER stress-related proteins in primary salivary adenoid cystic carcinoma.
23029344 2012 Beclin-1 expression is a significant predictor of survival in patients with lymph node-positive gastric cancer.
22933281 2012 Foot-and-mouth disease virus nonstructural protein 2C interacts with Beclin1, modulating virus replication.
22875631 2012 The heme oxygenase-1 inhibitor ZnPPIX induces non-canonical, Beclin 1-independent, autophagy through p38 MAPK pathway.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22805532 2012 Beclin 1 influences cisplatin-induced apoptosis in cervical cancer CaSki cells by mitochondrial dependent pathway.
22797916 2012 Beclin-1-interacting autophagy protein Atg14L targets the SNARE-associated protein Snapin to coordinate endocytic trafficking.
22742832 2012 Bim inhibits autophagy by recruiting Beclin 1 to microtubules.
22733132 2013 Beclin 1 and autophagy are required for the tumorigenicity of breast cancer stem-like/progenitor cells.
22674982 2012 Hepatitis C virus upregulates Beclin1 for induction of autophagy and activates mTOR signaling.
22650021 2012 [The expressions and correlation of bcl-2 and Beclin-1 in pancreatic cancer].
22648564 2012 Expression of Beclin 1 and LC3 in FIGO stage I-II cervical squamous cell carcinoma and relationship to survival.
22627130 2012 Deregulation of Beclin 1 in patients with tobacco-related oral squamous cell carcinoma.
22498477 2012 The anti-apoptotic Bcl-B protein inhibits BECN1-dependent autophagic cell death.
22493499 2012 Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex.
22393062 2012 Involvement of Beclin 1 in engulfment of apoptotic cells.
22392728 2012 Histone deacetylase 6 functions as a tumor suppressor by activating c-Jun NH2-terminal kinase-mediated beclin 1-dependent autophagic cell death in liver cancer.
22335943 2011 [Effect of autophagy gene Beclin 1 on the growth of cervical cancer HeLa cells in vitro and vivo].
22314358 2012 Imperfect interface of Beclin1 coiled-coil domain regulates homodimer and heterodimer formation with Atg14L and UVRAG.
22310240 2012 Crystal structure and biochemical analyses reveal Beclin 1 as a novel membrane binding protein.
22301112 2012 The decreased expression of Beclin-1 correlates with progression to esophageal adenocarcinoma: the role of deoxycholic acid.
22248718 2012 miR-376b controls starvation and mTOR inhibition-related autophagy by targeting ATG4C and BECN1.
22242123 2011 The E1B19K oncoprotein complexes with Beclin 1 to regulate autophagy in adenovirus-infected cells.
22240664 2012 Low expression of Beclin 1, associated with high Bcl-xL, predicts a malignant phenotype and poor prognosis of gastric cancer.
22205736 2012 The human cytomegalovirus protein TRS1 inhibits autophagy via its interaction with Beclin 1.
22157765 2012 MicroRNA-30a sensitizes tumor cells to cis-platinum via suppressing beclin 1-mediated autophagy.
22147978 2011 Autophagy-related proteins Beclin-1 and LC3 predict cetuximab efficacy in advanced colorectal cancer.
22095667 2012 Decreased expression of Beclin 1 correlates with a metastatic phenotypic feature and adverse prognosis of gastric carcinomas.
22081109 2011 Inhibition of autophagy by TAB2 and TAB3.
22039439 2011 Galectin-3 and Beclin1/Atg6 genes in human cancers: using cDNA tissue panel, qRT-PCR, and logistic regression model to identify cancer cell biomarkers.
22028648 2011 An integrated approach to elucidate the intra-viral and viral-cellular protein interaction networks of a gamma-herpesvirus.
21962518 2011 Beclin1 controls the levels of p53 by regulating the deubiquitination activity of USP10 and USP13.
21936852 2012 Nedd4-dependent lysine-11-linked polyubiquitination of the tumour suppressor Beclin 1.
21875280 2011 Beclin1 overexpression inhibitis proliferation, invasion and migration of CaSki cervical cancer cells.
21873141 Overexpression of autophagy-related beclin-1 in cutaneous squamous cell carcinoma with lymph-node metastasis.
21861179 2011 The significance of expression of autophagy-related gene Beclin, Bcl-2, and Bax in breast cancer tissues.
21779982 2011 The expression of p33(ING1), p53, and autophagy-related gene Beclin1 in patients with non-small cell lung cancer.
21777947 2012 Decreased Beclin-1 expression is correlated with the growth of the primary tumor in patients with squamous cell carcinoma and adenocarcinoma of the lung.
21769915 2011 Autophagy in hypoxia protects cancer cells against apoptosis induced by nutrient deprivation through a Beclin1-dependent way in hepatocellular carcinoma.
21750416 2011 cAMP induces autophagy via a novel pathway involving ERK, cyclin E and Beclin 1.
21729531 2011 [Expression of autophagy related gene Beclin1 and MAPLC3 in bone marrow mononuclear cells isolated from acute leukemia patients and its significance].
21722286 2011 Shiga toxins induce autophagy leading to differential signalling pathways in toxin-sensitive and toxin-resistant human cells.
21711108 2011 Beclin1/PI3K-mediated autophagy prevents hypoxia-induced apoptosis in EAhy926 cell line.
21681342 2011 [Inhibition of Beclin 1 enhances apoptosis by H2O2 in glioma U251 cells].
21654208 2011 Prognostic significance of Beclin 1 in intrahepatic cholangiocellular carcinoma.
21646862 2011 Beclin 1-independent autophagy contributes to apoptosis in cortical neurons.
21610315 2011 Cleaving Beclin 1 to suppress autophagy in chemotherapy-induced apoptosis.
21597469 2011 UV irradiation resistance-associated gene suppresses apoptosis by interfering with BAX activation.
21556768 2012 Decreased expression of Beclin-1 and LC3 in human lung cancer.
21537144 2011 Beclin-1 and LC3A expression in cutaneous malignant melanomas: a biphasic survival pattern for beclin-1.
21499230 2011 Autophagy patterns and prognosis in uveal melanomas.
21478185 2011 Overexpression of the autophagic beclin-1 protein clears mutant ataxin-3 and alleviates Machado-Joseph disease.
21444671 2011 Following cytochrome c release, autophagy is inhibited during chemotherapy-induced apoptosis by caspase 8-mediated cleavage of Beclin 1.
21420796 2011 Clinicopathologic correlation of beclin-1 expression in pancreatic ductal adenocarcinoma.
21364619 2010 Caspase-mediated cleavage of Beclin-1 inactivates Beclin-1-induced autophagy and enhances apoptosis by promoting the release of proapoptotic factors from mitochondria.
21358617 2011 Mitochondrial BCL-2 inhibits AMBRA1-induced autophagy.
21353614 2011 Oncogenic Ras-induced expression of Noxa and Beclin-1 promotes autophagic cell death and limits clonogenic survival.
21327823 2011 Association of elevated HIF-2? levels with low Beclin 1 expression and poor prognosis in patients with chondrosarcoma.
21241894 2011 RalB and the exocyst mediate the cellular starvation response by direct activation of autophagosome assembly.
21239722 2011 A role for autophagic protein beclin 1 early in lymphocyte development.
21209283 2011 NLRP4 negatively regulates autophagic processes through an association with beclin1.
21203962 2010 Beclin 1 cleavage by caspase-3 inactivates autophagy and promotes apoptosis.
21139567 2011 MCL-1 is a stress sensor that regulates autophagy in a developmentally regulated manner.
21081164 2011 Depletion of Beclin-1 due to proteolytic cleavage by caspases in the Alzheimer's disease brain.
21062745 2011 The RUN domain of rubicon is important for hVps34 binding, lipid kinase inhibition, and autophagy suppression.
20937944 2010 Beclin 1 complex in autophagy and Alzheimer disease.
20863706 2010 Reduced expression of LC3B-II and Beclin 1 in glioblastoma multiforme indicates a down-regulated autophagic capacity that relates to the progression of astrocytic tumors.
20842118 2010 Beclin 1 over- and underexpression in colorectal cancer: distinct patterns relate to prognosis and tumour hypoxia.
20819940 2010 Endogenous HMGB1 regulates autophagy.
20697744 2010 Age at onset in Huntington's disease is modified by the autophagy pathway: implication of the V471A polymorphism in Atg7.
20643123 2010 A phosphatidylinositol 3-kinase class III sub-complex containing VPS15, VPS34, Beclin 1, UVRAG and BIF-1 regulates cytokinesis and degradative endocytic traffic.
20639699 2010 Beclin 1 expression: a predictor of prognosis in patients with extranodal natural killer T-cell lymphoma, nasal type.
20638385 2010 Interaction of Beclin 1 with survivin regulates sensitivity of human glioma cells to TRAIL-induced apoptosis.
20562859 2010 Network organization of the human autophagy system.
20559548 2010 Regulation of amyloid precursor protein processing by the Beclin 1 complex.
20473282 2010 Autophagy-active beclin-1 correlates with favourable clinical outcome in non-Hodgkin lymphomas.
20454448 2010 14-3-3Tau regulates Beclin 1 and is required for autophagy.
20368806 2010 Simultaneous induction of non-canonical autophagy and apoptosis in cancer cells by ROS-dependent ERK and JNK activation.
20230646 2010 Genetic and epigenetic silencing of the beclin 1 gene in sporadic breast tumors.
20208530 2010 PtdIns(3)P controls cytokinesis through KIF13A-mediated recruitment of FYVE-CENT to the midbody.
20207475 2010 Over-expression of the Beclin1 gene upregulates chemosensitivity to anti-cancer drugs by enhancing therapy-induced apoptosis in cervix squamous carcinoma CaSki cells.
20206246 2010 Beclin-1 expression in normal bladder and in Cd2+ and As3+ exposed and transformed human urothelial cells (UROtsa).
20190558 2010 Morphine induces Beclin 1- and ATG5-dependent autophagy in human neuroblastoma SH-SY5Y cells and in the rat hippocampus.
20150769 2010 Elevated Beclin 1 expression is correlated with HIF-1alpha in predicting poor prognosis of nasopharyngeal carcinoma.
20090905 2010 Differential dependence on Beclin 1 for the regulation of pro-survival autophagy by Bcl-2 and Bcl-xL in HCT116 colorectal cancer cells.
20037818 2009 Expression of Beclin1 in osteosarcoma and the effects of down-regulation of autophagy on the chemotherapeutic sensitivity.
20023428 2010 Beclin 1 modulates the anti-apoptotic activity of Bcl-2: insights from a pathogen infection system.
20010695 2010 Antagonism of Beclin 1-dependent autophagy by BCL-2 at the endoplasmic reticulum requires NAF-1.
20009549 2010 Targeting Beclin 1 for viral subversion of macroautophagy.
20004946 2010 Beclin 1 and LC3 autophagic gene expression in cutaneous melanocytic lesions.
19959994 2010 The IKK complex contributes to the induction of autophagy.
19921231 2010 Decreased expression of Beclin 1 in eutopic endometrium of women with adenomyosis.
19798108 2010 Coxiella burnetii modulates Beclin 1 and Bcl-2, preventing host cell apoptosis to generate a persistent bacterial infection.
19778902 2010 Oncogenic ras-induced down-regulation of autophagy mediator Beclin-1 is required for malignant transformation of intestinal epithelial cells.
19762066 2010 Clinicopathologic correlation of beclin-1 and bcl-2 expression in human breast cancer.
19713971 2010 Apoptosis blocks Beclin 1-dependent autophagosome synthesis: an effect rescued by Bcl-xL.
19680556 2009 Genetic variation in healthy oldest-old.
19641499 2008 The autophagy effector Beclin 1: a novel BH3-only protein.
19556884 2009 The prognostic role of Beclin 1 protein expression in high-grade gliomas.
19535919 2009 Regulation of autophagy by a beclin 1-targeted microRNA, miR-30a, in cancer cells.
19535901 2009 Why doesn't Beclin 1, a BH3-only protein, suppress the anti-apoptotic function of Bcl-2?
19520853 2009 A non-canonical MEK/ERK signaling pathway regulates autophagy via regulating Beclin 1.
19395874 2009 Phosphorylation of Beclin 1 by DAP-kinase promotes autophagy by weakening its interactions with Bcl-2 and Bcl-XL.
19375507 2009 Autophagy and the functional roles of Atg5 and beclin-1 in the anti-tumor effects of 3beta androstene 17alpha diol neuro-steroid on malignant glioma cells.
19372752 2009 Regulation of Beclin 1 in autophagy.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19347031 2009 Bcl-2 complexed with Beclin-1 maintains full anti-apoptotic function.
19325567 2009 The inositol 1,4,5-trisphosphate receptor regulates autophagy through its interaction with Beclin 1.
19318089 2009 Upregulation of Beclin-1 expression and phosphorylation of Bcl-2 and p53 are involved in the JNK-mediated autophagic cell death.
19298604 2009 HAb18G/CD147 inhibits starvation-induced autophagy in human hepatoma cell SMMC7721 with an involvement of Beclin 1 down-regulation.
19298526 2009 Endostatin induces autophagy in endothelial cells by modulating Beclin 1 and beta-catenin levels.
19289499 2009 p65/RelA modulates BECN1 transcription and autophagy.
19273585 2009 Hypoxia-induced autophagy is mediated through hypoxia-inducible factor induction of BNIP3 and BNIP3L via their BH3 domains.
19270696 2009 Two Beclin 1-binding proteins, Atg14L and Rubicon, reciprocally regulate autophagy at different stages.
19270693 2009 Distinct regulation of autophagic activity by Atg14L and Rubicon associated with Beclin 1-phosphatidylinositol-3-kinase complex.
19218137 2009 [Expression of Beclin1 in primary hepatocellular carcinoma].
19180116 2009 DAP-kinase-mediated phosphorylation on the BH3 domain of beclin 1 promotes dissociation of beclin 1 from Bcl-XL and induction of autophagy.
19145109 2009 Prognostic significance of Beclin 1-dependent apoptotic activity in hepatocellular carcinoma.
19130303 2009 Beclin-1 expression is a predictor of clinical outcome in patients with esophageal squamous cell carcinoma and correlated to hypoxia-inducible factor (HIF)-1alpha expression.
19066461 2009 The expression of beclin 1 is associated with favorable prognosis in stage IIIB colon cancers.
19060920 2009 The pivotal role of c-Jun NH2-terminal kinase-mediated Beclin 1 expression during anticancer agents-induced autophagy in cancer cells.
19050071 2008 Identification of Barkor as a mammalian autophagy-specific factor for Beclin 1 and class III phosphatidylinositol 3-kinase.
18843052 2008 Beclin 1 forms two distinct phosphatidylinositol 3-kinase complexes with mammalian Atg14 and UVRAG.
18829541 2008 Regulation of estrogenic effects by beclin 1 in breast cancer cells.
18797192 2008 Molecular basis of the regulation of Beclin 1-dependent autophagy by the gamma-herpesvirus 68 Bcl-2 homolog M11.
18769161 2008 Beclin 1 bridges autophagy, apoptosis and differentiation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18641390 2008 Bcl-xL and UVRAG cause a monomer-dimer switch in Beclin1.
18628207 2008 Vitamin D3 induces autophagy of human myeloid leukemia cells.
18552835 2008 Beclin1-binding UVRAG targets the class C Vps complex to coordinate autophagosome maturation and endocytic trafficking.
18497889 2008 The autophagy-related protein beclin 1 shows reduced expression in early Alzheimer disease and regulates amyloid beta accumulation in mice.
18497881 2008 Regulation of Abeta pathology by beclin 1: a protective role for autophagy?
18184459 2008 [Expression of autophagy-related genes Beclin1 and MAPLC3 in non-small cell lung cancer].
18184403 2007 Expression of beclin-1, an autophagy-related protein, in gastric and colorectal cancers.
18005679 2007 HSV-1 ICP34.5 confers neurovirulence by targeting the Beclin 1 autophagy protein.
17999086 2008 Immunolocalization of beclin 1, a bcl-2-binding, autophagy-related protein, in the human ovary: possible relation to life span of corpus luteum.
17786023 Role of autophagy in breast cancer.
17724469 2008 Reduced expression of vacuole membrane protein 1 affects the invasion capacity of tumor cells.
17659302 2007 Molecular basis of Bcl-xL's target recognition versatility revealed by the structure of Bcl-xL in complex with the BH3 domain of Beclin-1.
17643073 Differential interactions between Beclin 1 and Bcl-2 family members.
17595761 Beclin 1 gene inhibits tumor growth in colon cancer cell lines.
17589504 2007 Ambra1 regulates autophagy and development of the nervous system.
17550384 2007 Somatic mutations of BECN1, an autophagy-related gene, in human cancers.
17446862 2007 Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1.
17441338 2007 [Expression and involved signal transduction pathway of autophagy gene Beclin 1 in epithelial ovarian cancer].
17441324 2007 [Construction of shRNA expression vectors for autophagy gene Beclin 1 and effect of the vectors on transfected HeLa cells in vitro].
17438366 BH3-only proteins and BH3 mimetics induce autophagy by competitively disrupting the interaction between Beclin 1 and Bcl-2/Bcl-X(L).
17355787 2007 [Correlation of autophagy gene Beclin1 to tumorigenesis and development of epithelial ovarian cancer].
17337444 2007 Crystal structure of the Bcl-XL-Beclin 1 peptide complex: Beclin 1 is a novel BH3-only protein.
17272502 2007 Kringle 5 of human plasminogen, an angiogenesis inhibitor, induces both autophagy and apoptotic death in endothelial cells.
17236580 2006 [Expression and clinical significance of autophagy gene Beclin 1 in cervical squamous cell carcinoma].
17203225 2007 Protein and mRNA expression of autophagy gene Beclin 1 in human brain tumours.
16874027 2005 The evolutionarily conserved domain of Beclin 1 is required for Vps34 binding, autophagy and tumor suppressor function.
16857678 2006 NF-kappaB activation represses tumor necrosis factor-alpha-induced autophagy.
16718815 2006 Partial Beclin 1 silencing aggravates doxorubicin- and Fas-induced apoptosis in HepG2 cells.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16522639 2006 Regulation of intracellular accumulation of mutant Huntingtin by Beclin 1.
16417406 2006 Hem-1 complexes are essential for Rac activation, actin polymerization, and myosin regulation during neutrophil chemotaxis.
16390869 2006 Functional specificity of the mammalian Beclin-Vps34 PI 3-kinase complex in macroautophagy versus endocytosis and lysosomal enzyme trafficking.
16267277 2006 Characterization of an ERAD gene as VPS30/ATG6 reveals two alternative and functionally distinct protein quality control pathways: one for soluble Z variant of human alpha-1 proteinase inhibitor (A1PiZ) and another for aggregates of A1PiZ.
16179260 2005 Bcl-2 antiapoptotic proteins inhibit Beclin 1-dependent autophagy.
15922724 2005 Beclin 1 augmented cis-diamminedichloroplatinum induced apoptosis via enhancing caspase-9 activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14970205 2004 Ceramide-mediated macroautophagy involves inhibition of protein kinase B and up-regulation of beclin 1.
14966907 2004 Genes encoding Pir51, Beclin 1, RbAp48 and aldolase b are up or down-regulated in human primary hepatocellular carcinoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12372286 2002 A novel protein complex linking the delta 2 glutamate receptor and autophagy: implications for neurodegeneration in lurcher mice.
11564866 2001 Use of chromatin immunoprecipitation to clone novel E2F target promoters.
11309306 2001 Beclin 1 contains a leucine-rich nuclear export signal that is required for its autophagy and tumor suppressor function.
11306555 2001 Beclin-phosphatidylinositol 3-kinase complex functions at the trans-Golgi network.
10604474 1999 Induction of autophagy and inhibition of tumorigenesis by beclin 1.
10395800 1999 Cloning and genomic organization of beclin 1, a candidate tumor suppressor gene on chromosome 17q21.
9765397 1998 Protection against fatal Sindbis virus encephalitis by beclin, a novel Bcl-2-interacting protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.
7490091 1995 Generation of a transcription map at the HSD17B locus centromeric to BRCA1 at 17q21.