Property Summary

NCBI Gene PubMed Count 18
PubMed Score 164.77
PubTator Score 60.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Retinoblastoma 14 3.835 1.9

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.534 2.7e-05
juvenile dermatomyositis 1.267 6.2e-12
acute quadriplegic myopathy 1.302 9.0e-06
psoriasis -1.100 3.1e-08
Pick disease -1.800 7.9e-05
progressive supranuclear palsy -1.600 2.0e-02

Gene RIF (5)

PMID Text
24312468 Linkage study and exome sequencing identify a BDP1 mutation associated with hereditary hearing loss.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18391023 PTEN represses RNA polymerase III-dependent transcription by targeting the TFIIIB complex
17499043 Maf1 occupancy of Pol III genes is inversely correlated with that of the initiation factor TFIIIB (subunit Bdp1) and Pol III
15096501 Human BDP1 protein represents essential components of TFIIIC1 and TFIIIC1-like activities.

AA Sequence

MFRRARLSVKPNVRPGVGARGSTASNPQRGRESPRPPDPATDSASKPAEPTDVPTVDFGGAEPQEKAPRS      1 - 70
STEKTGGDNDVEESSRSSSTVSQRRKRISSTSSLVKSSVSVPSESHPLSTINQEAPQPTATSTKEKQPCS     71 - 140
DRYRIYKAQKLREMLKEELRKEKKQWKNKYAINESQRPPDRSKMTMRDFIYYLPDNNPMTSSLEQEKKTE    141 - 210
KPSTPVQTREQEGKSTPNAEDNEMEEETDDGPLLVPRVKVAEDGSIILDEESLTVEVLRTKGPCVVEEND    211 - 280
PIFERGSTTTYSSFRKNYYSKPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKREEKTNGW    281 - 350
RIDKAFQEKRPFDFDFFAHLLQKVLAEEEKRKQKSVKNHSLKEKKSTKPRKNVKVKKVACEGVNNDPDES    351 - 420
MSSRISDTERSQKDAQTVEEESLTLSREDAEQVALEVDLNQKKRRRKKQDGANELGVNNLLENATVQAGP    421 - 490
SKGEKHKNKCQAIRPELKEGECSKEQMLSCTQNIDGIVGFASTEKVEKRTDPILSLSNQQDATSVATESS    491 - 560
ESSTSDLPSFEVGIRALCEVNNAEGSCIEERNVDLKNNSLEIDQTENVKPMLRGRFQRPKPNLSRAGKKS    561 - 630
VLSQGKTESESKNSHSKTSVEKNHVEKDKMNTLDILRMETTERENPEAETVSVLGEKNCLQEGSQLKALR    631 - 700
PVQVRGRLQKPKPNAGKAAERKEILISQEEIGANVEKNENESCADRDTPQHMEDQSRKDFEEEDVILQPE    701 - 770
KNDSFQNVQPDEPKVLNECLSVQENNKANKLNQVPILRTRFQKPKPNIGRGTGRREISSKEEVLEKILVS    771 - 840
GEMAAALRETVRLDTSPKEMVPAEINTKEMQSDLKETGRRAISPREKILDVIDDTIEMETGLKAMGREIC    841 - 910
LREKTPEVIDATEEIDKDLEEAGRREISPQKNGPEEVKPLGEVETDLKATGNESSPREKTPEVTDATEEI    911 - 980
DKNLEETGRRKISPRENGPEEVKPVDEMETDLNATGRESSPREKTPEVIDATEEIDLEETEREVSPQENG    981 - 1050
LEEVKPLGEMETDLKATGRDSFPRGKTPEVIDAIEEIEIDLEETEREISPQENGLEEVKPLGEMQTDLKA   1051 - 1120
TGREISPREKTPEVIDATEEIDKDLEETGRREISPEENGPEEVKPVDEMETDLKTTGREGSSREKTREVI   1121 - 1190
DAAEVIETDLEETEREISPQENGPEEVKPVGKMETDLKEIREEISQREKVLAEFSAIREKEIDLKETGKR   1191 - 1260
DIPIMEKVSGKMAVVEEMEADLKETGKENFRERGSEEICVTEEKVAELKQTGKTDISPRENELEETSTSR   1261 - 1330
QTDTHLMQSGSNDFSAVPSLDIQNISSEVLSMMHTPVEEKRNSEKEVSSHFSHFKISSQTHESDKTEVQG   1331 - 1400
IQSPDVPEQFSDINLSKSLPQEQKPLEIKPAPFVRSRFKRPKPNLARAALKRETTESEKYIYEKKSETKK   1401 - 1470
METIVMQENNEQTDTLPSQHDEASLMISREKDTLGHRNEEAVILPCTQTERNLSPSNSCEPKEESQSAPV   1471 - 1540
QKNDSVVSVGTNNVNTFQQEMKESVIQTARQVRGRLQRPRPNIRKTGQRQIVDKGEAKGIIKEGRTILPK   1541 - 1610
DETEKKVLTVSNSQIETEIEVPSSAVPEHRMYENQSQVVLVENLHVNKTNETIRHENKPYVPSSAQMTRR   1611 - 1680
KFQKAKPNLGRAHSKKEEPVLEKVTTDQSKEGKPEDHLLQKGASNTQLLLKEKAELLTSLEVSARKDCVG   1681 - 1750
SKESALAKIDAELEEVGPSRRVGEETVGDNSPSSVVEEQYLNKLTSCPQPLNETSYSKIALDGKTTISST   1751 - 1820
SEYERNRGERRSHKKFKPNVTRGRGSKRVRGKTSKKEPRASKAMLVTLRASQEEDDDADDFESDYEEESY   1821 - 1890
HLAPEEVNKAPVFVPVGLRSPEPVSAQIEETMEELEITVNVPDVGCIAVVEHELPNTDVTTEEMKQEENL   1891 - 1960
SVPFEMTTSEHIQDEPGTNDGSTEAAITLLTMGDLVLQSEISSEQGDVGVCIIPHVHSKDKSHIPSSLDN   1961 - 2030
VNHKIVHECQELSSPVITTSPASFEENKIVLEEQSSREEISLMEKVKENATPTRNTISKVTSNLRIRSRL   2031 - 2100
AKPKPNLEKTLGTNRLDDYQEVSSLCVTKGAEMETQRETEKNASKATELENKNLGPVTTAENKDQSKLAC   2101 - 2170
VHGIKGTSISSEVNLTERNENQEESSQEVHMLSVAPVASSETGPCTLGLDRGLGENSVEEPQIKDSKGDS   2171 - 2240
VLTLPVPEYTPTSIPEVQQENIINPQDLTVNLVANVPQDGEDEQAFILTLVEIPANAVEEFTDATAQFMP   2241 - 2310
NPLLPAPILVKSVNTEERGDMSICLPATSVGQDAMGLSISGRDNSKKPPDNLDLVSRKRFQCRLDKNDHI   2311 - 2380
PPAKKRSLTLRDDCQEYTTEVHSKELTNVFEETGESHKGQDIFLTSGSTLTTPEPQRQQVEAAFQSRGSR   2381 - 2450
SPDACMDKNVPQLPQDEMIVSDKEERTDAAPKSQQMDSRTSSSKASLSRPGRRPLGFLSLICSKNSLESD   2451 - 2520
EPMQVHSKKRLKPLIPGLRKKLKRSNPFNESQEKNRESSDLLPSPSVITTQSENISSSATQVSCDQPLLK   2521 - 2590
EGYKSAQKRAPQGEATTVSEYFFNDIFIEVDETE                                       2591 - 2624
//

Text Mined References (27)

PMID Year Title
24312468 2013 Linkage study and exome sequencing identify a BDP1 mutation associated with hereditary hearing loss.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18391023 2008 PTEN represses RNA polymerase III-dependent transcription by targeting the TFIIIB complex.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17499043 2007 Mammalian Maf1 is a negative regulator of transcription by all three nuclear RNA polymerases.
16956891 2006 Epstein-Barr virus induces cellular transcription factors to allow active expression of EBER genes by RNA polymerase III.
16769183 2006 A role for Yin Yang-1 (YY1) in the assembly of snRNA transcription complexes.
16542149 2006 The zinc finger protein ZNF297B interacts with BDP1, a subunit of TFIIIB.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469824 2004 CK2 phosphorylation of Bdp1 executes cell cycle-specific RNA polymerase III transcription repression.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15096501 2004 Transcription factor (TF)-like nuclear regulator, the 250-kDa form of Homo sapiens TFIIIB", is an essential component of human TFIIIC1 activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14592981 2003 TFIIIB is phosphorylated, disrupted and selectively released from tRNA promoters during mitosis in vivo.
14527415 2003 A minimal RNA polymerase III transcription system from human cells reveals positive and negative regulatory roles for CK2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
11161782 2000 The transcription factor-like nuclear regulator (TFNR) contains a novel 55-amino-acid motif repeated nine times and maps closely to SMN1.
11121026 2000 A stable complex of a novel transcription factor IIB- related factor, human TFIIIB50, and associated proteins mediate selective transcription by RNA polymerase III of genes with upstream promoter elements.
11040218 2000 Different human TFIIIB activities direct RNA polymerase III transcription from TATA-containing and TATA-less promoters.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9171375 1997 Three human RNA polymerase III-specific subunits form a subcomplex with a selective function in specific transcription initiation.
9169441 1997 RNA polymerase III transcription repressed by Rb through its interactions with TFIIIB and TFIIIC2.