Property Summary

NCBI Gene PubMed Count 1,749
PubMed Score 10701.58
PubTator Score 5694.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Major Depressive Disorder 301
Alzheimer's disease 658
Alcohol abuse 50
Alcoholic Intoxication 34
Alcoholic Intoxication, Chronic 289
Anorexia nervosa 80
Aplasia/Hypoplasia of the iris 10
Autism Spectrum Disorders 75
Blepharoptosis 231
Body Temperature Changes 10
Cardiovascular Abnormalities 31
Cardiovascular Diseases 59
Cataract 297
Central hypoventilation 8
Congenital central hypoventilation 6
Constipation 181
Cryptorchidism 296
Deletion 11p13 3
Displacement of the external urethral meatus 3
Downward slant of palpebral fissure 158
Drug-induced depressive state 14
Dull intelligence 645
Dyschezia 135
Everted lower lip vermilion 54
Feeding difficulties 127
Ganglioneuroblastoma 11
Ganglioneuroma 13
Hearing abnormality 12
Hirschsprung Disease 31
Hyperhidrosis disorder 81
Hypoplastic mandible condyle 275
Increased sweating 81
Lens Opacities 231
Low Vision 174
Low intelligence 645
Low set ears 181
Mandibular hypoplasia 275
Megacolon 29
Mental Depression 333
Mental Retardation 645
Mental deficiency 645
Micrognathism 275
Mood Disorders 184
Mouth Abnormalities 14
Nystagmus 317
Poor school performance 645
Poor temperature regulation 10
Posteriorly rotated ear 61
Protruding lower lip 54
Short stature 531
Small head 374
Sweating 81
TOBACCO ADDICTION, SUSCEPTIBILITY TO (finding) 12
Tonic-clonic epilepsy 47
Unipolar Depression 250
Visual Impairment 174
Wilms Tumor, Aniridia, Genitourinary Anomalies, Mental Retardation, and Obesity Syndrome 1
nervous system disorder 53
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0
substance-related disorder 162 0.0 3.0
Disease Target Count Z-score Confidence
Opiate dependence 29 3.449 1.7
Disease Target Count
WAGR syndrome 10
BULN1 1
morbid obesity 3

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -2.300 3.9e-03
astrocytoma -1.900 2.4e-30
Astrocytoma, Pilocytic -2.000 6.8e-05
atypical teratoid / rhabdoid tumor -1.600 9.0e-03
ependymoma -2.500 5.8e-03
glioblastoma -2.400 3.6e-07
group 4 medulloblastoma -3.000 1.4e-05
interstitial cystitis 1.100 2.5e-02
interstitial lung disease -1.100 1.9e-02
lung adenocarcinoma -1.100 1.3e-18
lung cancer 3.100 8.3e-06
malignant mesothelioma -2.700 2.4e-08
medulloblastoma, large-cell -2.300 5.1e-03
oligodendroglioma -2.300 4.0e-03
ovarian cancer -1.200 1.0e-03
pituitary cancer -2.100 1.2e-06
primitive neuroectodermal tumor -2.300 1.7e-03

 CSPA Cell Line (1)

Gene RIF (1965)

AA Sequence

MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEEL      1 - 70
LDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSV     71 - 140
CDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRT    141 - 210
TQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR                                     211 - 247
//

Text Mined References (1750)

PMID Year Title