Property Summary

NCBI Gene PubMed Count 188
PubMed Score 0.00
PubTator Score 346.38

Knowledge Summary

Patent (12,693)

Protein-protein Interaction (293)

GNAT3   GRM8   CORT   F2RL2   P2RY10   CXCR6   CCL21   CXCL11   FFAR1   FFAR3   NPFF   GRM6   CCL25   CCL16   FFAR2   MLNR   ADCY6   GNRH2   GALR2   HCRT   HCRTR1   HCRTR2   CXCL13   KALRN   ADCY3   ADCY9   GALR3   GABBR2   TRIO   S1PR2   UTS2   ADCY5   NTSR2   GNA14   S1PR4   F2   C3   C5   KNG1   GNRH1   OXT   AVP   POMC   PENK   PDYN   GCG   PPY   NPY   GAST   PPBP   PF4   CXCL10   GNAI2   APP   EDN1   CCK   GRP   GNAI3   NMB   CXCL1   NPS   SAA1   ADORA3   PYY   CXCL8   MLN   CCL5   EDN3   DRD2   ADRA2C   GNAZ   CXCL2   CXCL3   TAC1   PMCH   TRH   EDN2   TACR2   S1PR1   FPR1   CNR1   C5AR1   TBXA2R   DRD4   GAL   EDNRB   CXCR1   CXCR2   FPR3   FPR2   EDNRA   TACR1   PTAFR   ACKR3   F2R   NPY1R   PIK3R1   HTR2C   NMBR   TACR3   GNA11   GRPR   OXTR   GNA15   SSTR1   SSTR2   GNRHR   NTSR1   NTS   SSTR4   CCKAR   CCKBR   CCR1   CCR7   CXCR5   SSTR3   GRK5   CNR2   TRHR   PTGER1   SSTR5   HRH1   OPRM1   DRD3   AVPR1A   ADCY8   OPRD1   OPRK1   OPRL1   CASR   P2RY2   GRM5   CCR2   PIK3CA   CXCL5   PTGFR   PTGER3   LPAR6   CCR10   GPR4   XCR1   GALR1   GCGR   P2RY1   AVPR1B   XCL1   MTNR1A   CXCL12   NPBWR1   NPBWR2   NMU   PIK3CG   HCAR3   NPY2R   MTNR1B   CXCR3   GNAQ   NPY4R   P2RY4   CCR3   CCR4   CCR5   CCR6   CCR8   CCR9   ADCY7   F2RL1   CCL23   PROK1   TAS2R38   TAS2R39   TAS2R40   TAS2R41   TAS2R43   TAS2R31   TAS2R45   TAS2R46   TAS2R30   TAS2R19   TAS2R20   TAS2R50   TAS2R60   GNG2   CXCR4   SST   GNB1   GNAI1   CCL20   CXCL6   QRFP   PLCB2   PLCB3   GNA12   CXCL9   ADCY2   ADCY1   GRM1   GPR17   PNOC   GPR18   GNA13   GRM2   GRM7   GRM3   GRM4   P2RY6   PLCB4   P2RY14   LTB4R   KISS1   GPR68   NPY5R   C3AR1   NMS   GPRC6A   PIK3R6   NPSR1   UTS2B   TAS2R42   ARHGEF25   MT-RNR2   GPR65   NPW   PROKR2   ADCY4   NPB   PROKR1   HCAR2   OXER1   RXFP4   RLN3   PIK3R5   LPAR1   GHSR   ARHGEF1   KISS1R   MCHR2   P2RY11   QRFPR   OXGR1   GNRHR2   F2RL3   S1PR3   GPER1   LPAR4   MCHR1   CCL19   P2RY13   SUCNR1   HCAR1   NMUR2   NPFFR1   LPAR5   S1PR5   P2RY12   CXCL16   HRH4   NMUR1   LPAR2   PROK2   LTB4R2   PLCB1   CCL28   HEBP1   CYSLTR2   RXFP3   TAS2R16   TAS2R14   TAS2R13   TAS2R10   TAS2R9   TAS2R8   TAS2R7   TAS2R5   TAS2R4   TAS2R3   TAS2R1   ARHGEF12   XCL2   GABBR1   GHRL   LPAR3   TAC3   OPN4   UTS2R   GPR132   CYSLTR1   GPR55   CCL27   HRH3   INSL5   NPFFR2   PTGDR2  

MLP Assay (15)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay
686924 other 0 / 0 / 1 ML347 Eurofin Panel Assay for BMP Inhibitor (Probe Compound)
686925 other 0 / 0 / 1 ML352 Eurofin Panel Assay for Choline Transporter Inhibitor (Probe Compound)
686926 other 0 / 0 / 1 ML354 Eurofin Panel Assay for PAR4 Antagonists Inhibitor (Probe Compound)
686927 other 0 / 0 / 1 ML353 Eurofin Panel Assay for mGlu5 SAM Inhibitor (Probe Compound)
743249 screening 1 / 0 / 0 Development of the First Potent, Selective and CNS penetrant M5 Negative Allosteric Modulator (NAM)
More...

Gene RIF (178)

PMID Text
26907838 These results suggest that the response to long-term exercise training could be modulated by the BDKRB2 gene -9/+9 polymorphism in male athletes. In well-trained swimmers, BDKRB2 gene variation was not found to be an independent determinant of swimming performance.
26362411 Significant association between the -58T/C polymorphism and the increased risk of Hypertension was found in Northern Han Chinese population.
26360782 Bradykinin inhibits oxidative stress-induced senescence of endothelial progenitor cells through the B2R/AKT/RB and B2R/EGFR/RB signal pathways.
26235941 A cross-talk was found between bradykinin B2 receptor and cytokines in retinal pigment epithelium.
25970620 The nasal mucosa specimens from chronic rhinosinusitis patients expressed relatively higher B2R and slightly higher kininogen (KNG)/BK and B1R.
25842860 Bradykinin receptor B2-VNTR length polymorphism was not associated with angina pectoris and myocardial infarction in Russian men.
25713410 These results indicate that B2R couples with P2Y2R and that these G-protein-coupled receptors act together to fine-tune cellular responsiveness.
25641172 Bradykinin receptor B2 (B2R) genetic variation may affect thirst because of effects bradykinin activity.
25529519 Genetic variation was observed in obese patients with hypertension, obese patients' total cholesterol levels varied by genotype, and waist circumference and blood pressure were elevated in the non-obese having a C/C genotype compared to T/C and T/T.
25289859 kB1R heterodimerizes with kB2Rs in co-transfected HEK293 cells and natively expressing endothelial cells, resulting in significant internalization and desensitization of the kB1R response in cells pre-treated with kB2R agonist.
25109623 Bradykinin increases IL-6 production via B2R and the ERK pathway, thereby contributing to the invasion and migration of colorectal cancer cells.
25078958 no association between the -9/+9 polymorphism and elite athletic status
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of bradykinin receptor B2 (BDKRB2) in primary human brain microvascular endothelial cells
24401952 BKR1 and BKR2 gene expression on peripheral monocytes is upregulated in essential hypertension
24304135 B2 receptor-mediated relaxation reduced in myometrial vessels in pre-eclampsia
24236827 Bradykinin activates multiple signal transduction pathways in human trabecular meshwork cells via B2-receptors that also mediate intraocular pressure reduction
24211782 We propose that heterodimerization of bradykinin B2 receptor with lamin C is essential to nuclear localization of bradykinin B2 receptor and plays an important role in cell signaling and function.
24047499 Bradykinin induces ATP release from human subcutaneous fibroblasts via connexin and pannexin-1-containing hemichannels leading to [Ca2+]i mobilization through the cooperation of B2 and P2Y12 receptors
23805043 These studies have provided evidence of a functional endogenously expressed B-receptor system in the ciliary muscle that appears to be involved in modulating intraocular pressure.
23730990 Our data suggest that the B -9 allele and reduced ACE activity are associated with both ACE-AE and ACE-cough.
23613132 These results suggest that reflex muscle vasodilation and ACE activity in response to exercise training are modulated by BDKRB gene +9/-9 polymorphism in healthy individuals.
23588115 Bradykinin induced asthmatic fibroblast/myofibroblast activities via bradykinin B2 receptor and different MAPK pathways.
23454239 Dominant negative (GDP-locked)-Rab5 and -Rab11 reproduced the effects of inhibitors of tubulin and actin, respectively, on the cycling of bradykinin B receptor.
23428345 This review focuses on airway MAPK/NFkappaB-dependent kinin receptor upregulation that links the environmental risk factors to airway hyperreactivity and airway inflammation.
23362199 there is a higher frequency of the D allele (high plasma ACE activity) and +9 allele (lower B2R expression) in transplant patients compared with control individuals
23351078 investigated if expression of B1 and B2 kinin receptors can be affected by IL-4 and IL-13; data show, for the first time, that IL-4 and IL-13 decrease kinin receptors in a STAT6-dependent mechanism
23275384 In coronary artery disease patients, bradykinin-B2-receptor downregulation on endothelial repair-promoting circulating mononuclear cells substantially impairs bradykinin-dependent endothelial repair.
23243416 Suggest that the BDKRB2 +9/-9 polymorphism may act as a genetic modulator of glucose homeostasis and increase susceptibility to diabetes.
23224295 the relevance of kinin B1 and B2 receptors in bladder cancer, was investigated.
23176367 results suggest that the co-existence of ACE (D/D), BDKRB2 (+9/-9) or LEP (G/A) genotypes in female athletes might be correlated with a superior level of physical performance
23132855 Kinin-B2 receptor activity determines the differentiation fate of neural stem cells.
23127247 Triceps brachii morphological response to targeted strength training--hypertrophy--is related to bradykinin type (BK)2 receptor polymorphisms.
23093849 The +9/-9 bp polymorphisms of BDKRB2 gene may be used as a genetic marker for the susceptibility and severity of OA.
22935637 Bradykinin up-regulates B(2) receptor expression (P<0.05) and stimulate IL-8 release (P<0.001) in BEAS-2B cells.
22900090 The BDKRB2-58T/C gene polymorphism is associated with increased EH risk. The results of this study suggest that carriers of the -58C allele are susceptible to EH.
22706620 Our findings suggest that both eNOS and bradykinin B2 receptor genotypes may affect the antihypertensive responses to enalapril.
22706224 expression showed a growing trend with grade of endometrial cancer, reaching the peak in grade 2, whereas grade 3 was characterized by a decrease in transcriptional activity
22653778 Bradykinin enhances cell migration in human prostate cancer cells through B2 receptor/PKCdelta/c-Src dependent signaling pathway.
22468762 While -58C>T polymorphism did not reveal any association with essential hypertension, +/-9 bp polymorphism showed a significant association with high risk for heterozygotes (+9/-9) when tested against the pooled frequencies of homozygotes.
22304584 Capillary electrophoresis is a rapid, accurate and sensitive method for genotyping the 9-bp exon 1 insertion/deletion polymorphism in BDKRB2.
22108573 Maximakinin is an agonist of the human and rabbit B(2)R with a 8-12 fold lesser potency.
22047990 Human endothelial cells (HBMECs) infected with SINV presented an upregulation of bradykinin B2 receptors (BK2R) expression
22016392 Results demonstrate that helix 8 of the B(2)R plays a crucial role not only in efficient trafficking to the plasma membrane or the activation of G proteins but also for the interaction of the B(2)R with GRK2/3 and beta-arrestins.
21986469 Aging cardiac endothelial cells gradually lose their capacity to express BK-2Rs.
21871009 Comparing phospholipase C beta activity and Ca(2+)-regulated signals, a temperature-dependent increase was only observed for bradykinin B(1) but not for bradykinin(2)receptor activation.
21719759 Bradykinin receptors positively affect arteriogenesis, with the contribution of B1R receptor being more pronounced than that of B2R.
21626144 This study demonstrates that Pseudomonas aeruginosa is able to up-regulate the expression of B2R during infection via the NF-kappaB signaling pathway.
21602894 IRX1 influences peritoneal spreading and metastasis via inhibiting BDKRB2-dependent neovascularization on gastric cancer.
21600887 Taken together confocal FRET imaging revealed efficient heterodimerization of co-enriched and cellular AT1/B2R, and GRK-dependent co-internalization of the AT1/B2R heterodimer.
21586566 High molecular weight kininogen activates B2 receptor signaling pathway in human vascular endothelial cells.
21451024 Glioma cells from patient biopsies use B2R to sense bradykinin cleaved by vascular endothelial cells, using this signal to identify and connect with blood vessels as they invade the vasculature.
21210858 Tested the influence of the interaction between the BDKRB2 -9/+9 and the GNB3 C825T (rs5443) genotypes in relation to endurance performance. There was no interaction between BDKRB2 -9/+9 and GNB3 C825T polymorphisms in relation to endurance.
21145390 actiaved-Bradykinin Receptor can form a complex with beta arrestin and ERK1/2, both at the plasma membrane and on endosomes
21108627 From the different affinity of MEN16132 derivatives at wild type and W86A (transmembrane 2 region) receptors, and by evaluating its antagonist profile at the D266A/D284A double mutant receptor, a model of the MEN16132-B receptor complex is proposed.
21052031 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20952631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20944660 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20856803 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602751 Observational study of gene-disease association. (HuGE Navigator)
20592051 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20511677 Observational study of gene-disease association. (HuGE Navigator)
20473401 Down regulation of calreticulin expression by RNA interference confirmed the importance of calreticulin for efficient B(2) receptor maturation under in vivo conditions.
20300066 Three polymorphisms that are associated with the variation in baroreflex sensitivity were identified in the eNOS, CYP11B2, and B2R genes, respectively; overall, they accounted for 16% of the BRS variation.
20300066 Observational study of gene-disease association. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20189583 Remote ischemic preconditioning decreases expression of kinin receptors on circulating human neutrophils.
20050188 our findings suggest that bradykinin and bradykinin B2 receptors are involved in the modulation of mechanisms participating in inflammatory synovitis
20045189 B2R expression on monocytes and lymphocytes was lower in elderly compared to young women.
20044476 Observational study of gene-disease association. (HuGE Navigator)
20036225 results suggested that -58T allele exhibited a protective effect on hypertension in Asians and African-Americans, yet a risk effect in Caucasians
20036225 Meta-analysis of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19885862 human chondrosarcoma tissues had significantly higher expression of the B1 and B2 receptors comparing to normal cartilage
19854233 These data suggest that bradykinin B(2) receptors are expressed in human astrocytoma cells and that they modulate the expression pattern of inflammatory cytokines.
19744011 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19725054 B1R and B2R activation, which may result from an increase in BK synthesis, is involved in high glucose-induced stimulation of glutamate uptake, COX-2 expression, and NF-kB activation, in retinal pigment epithelium cells.
19716087 Observational study of gene-disease association. (HuGE Navigator)
19628666 endogenous bradykinin contributes to increases in MCP-1 and PAI-1 antigen after hemodialysis via its B(2) receptor.
19580784 calreticulin enhances B(2) receptor maturation and heterodimerization with AT(1).
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19565561 Mild hypoxia triggers a temporal expression of functional BK-2Rs in human and rat endothelial cells and support a role for BK-2Rs in hypoxia-induced angiogenesis.
19456859 Results suggest that bradykinin B2 receptor intracellular loops ICL-2 and ICL-3 are involved in G(q/11) activation, albeit with different functions.
19420105 Observational study of gene-disease association. (HuGE Navigator)
19404481 Epithelial cells, submucosal glands, fibroblast, vascular smooth muscle, vascular endothelial cells, and macrophages showed immunoreactivity for both B1 and B2 receptors. B2 receptors were found in peripheral nerve fibers.
19339996 Insertion/deletion polymorphism of the bradykinin type 2 receptor gene influence diastolic blood pressure
19339996 Observational study of gene-disease association. (HuGE Navigator)
19120546 The ratio of bradykinin subtype 1 receptor (B1R) to bradykinin subtype 2 receptor (B2R)is markedly higher in patients with acute coronary syndrome versus the age-matched healthy control group.
19110485 Observational study of gene-disease association. (HuGE Navigator)
19086053 The association of BDKRB2 to several psychiatric disorders supports the view that a common genetic variant could confer susceptibility to clinically related phenotypes, and defines a new functional hint in the pathophysiology of psychiatric diseases.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19082699 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19074839 Up-regulation of the B2R in head and neck cancers suggests that this pathway is involved in squamous cell tumorigenesis
19038786 Eosinophils in asthmatic patients expressed significantly greater kinin B(1)R and B(2)R mRNA and proteins
19017652 AT1R/B2R heterodimerization does not occur as a natural consequence of their simultaneous expression in the same cell nor does the B2R influence the AT1R signaling.
18938142 RT-PCR demonstrates the presence of mRNAs for brradykinin B2 receptors in a human embryo kidney cell line.
18927465 Blockade of the BRB2 by systemic administration of icatibant prevents the beneficial effect of bone marrow mononuclear cell transplantaation.
18810490 The authors show that bradykinin and the B(2)R play a role in early innate immune functions during listeria infection.
18672896 Results provide evidence of interaction of PECAM-1 with bradykinin receptor B2 and of its possible role in regulating G protein-coupled receptor (GPCR) and G protein functions.
18577888 The kallikrein-kinin system may be one of the more important players in angiogenesis associated with prostate and breast tumours.
18467203 These data show that IL-1beta and TNF-alpha upregulate B1 and B2 receptor expression by mechanisms involving activation of both NF-kappaB and MAP kinase pathways, but that signal transduction pathways are different for IL-1beta and TNF-alpha.
18430865 Bradykinin B2 receptor remains intact in cells overexpressing EP24.15 but is degraded intracellularly in an EP24.15-dependent manner upon B2R-mediated endocytosis.
18258629 Observational study of gene-disease association. (HuGE Navigator)
18187413 Carboxypeptidase M and kinin B1 receptors interact to facilitate efficient b1 signaling from B2 agonists
18180402 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18180402 BDKRB2 BE1 polymorphism influences bradykinin type 2 receptor-mediated vasodilation during angiotensin-converting enzyme inhibition.
18096516 Pro258 is required for normal trafficking of the receptor to the plasma membrane and that mutation of Pro258 to Ala or Leu but not Gly, enhances bradykinin efficacy to induce receptor activation.
18039523 Quantitative image analysis of fluorescence immunolabeled neutrophils showed no differences in kinin B(1) or B(2) receptor protein expression between asthmatic and non-asthmatic subjects.
17852785 The study showed a 2.5 fold higher transcriptional activity of bradykinin 2 receptor in patients with cardiac syndrom X than in control patients.
17593394 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17569300 The presence of AT1/B2-receptor heterodimers is involved in the hypertensive and oxidative stress states in pre-eclampsia.
17522594 Observational study of gene-disease association. (HuGE Navigator)
17522594 B2 receptor BE1 +9/+9 genotype has differential effects on blood pressure and vascular resistance in white and black Americans.
17420253 receptors are pre-coupled with their corresponding G proteins in the basal state of cells thereby limiting the response to an external signal to a defined stoichiometry that allows for a rapid and directed cellular response
17363739 Membrane disruption halts B(2)R internalization, invasion, and filopodia formation, which can be recovered with addition of cholesterol; functional recovery is severely impaired in the presence of CD13 antagonists
17328065 Kinin B1 and B2 receptors synergistically potentiate IL-1- and TNFalpha-induced PG biosynthesis in osteoblasts by a mechanism involving increased levels of COX-2, resulting in increased RANKL
17327486 The novel finding that kinin receptors are constitutively expressed in immature hMo-DC suggests that these receptors may be expressed in the absence of proinflammatory stimuli.
17303584 Observational study of gene-disease association. (HuGE Navigator)
17299793 human embryonic stem cells can be differentiated effectively into the epithelial lineage and that when differentiated express functional, signaling AT1 and BKB2 receptors
17207964 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17110500 kinins modulate receptor endocytosis to rapidly decrease B2R and increase B1R on the cell surface.
17077303 Heterodimer formation between angiotensin converting enzyme and B2 receptors can be a mechanism for ACE inhibitors to augment kinin activity at cellular level.
17030791 Data show that mechanical perturbation of the plasma membrane leads to ligand-independent conformational transitions in the bradykinin B2 G protein-coupled receptor.
16950802 Observational study of gene-disease association. (HuGE Navigator)
16740128 Confocal laser scanning microscopy and immunogold staining revealed that the recombinant receptor was predominantly localized intracellularly.
16600946 Observational study of gene-disease association. (HuGE Navigator)
16489763 Importantly, receptor sialylation and N-glycosylation participate with disulfide bonding in the stabilization of the cell surface human B2 receptor dimers.
16461337 Observational study of gene-disease association. (HuGE Navigator)
16461337 Both the nitric oxide synthase 3 (NOS3) and bradykinin receptor B2 (BDKRB2) genes are associated with the ultra-endurance performance that occurred during Ironman Triathlons.
16294326 Addition of BK or AngII to the cell line expressing WT AT1aR and BKB2R downregulated the expression of collagen alpha1(I) (COL1A1) mRNA. However, these effectors did not have this effect in cells expressing the mutant receptors.
16263113 B(2) receptor activation results in signaling via at least dual pathways - G(s)- and G(q)-mediated signaling.
16144969 These results identify novel pretranslational effects of the B2-VNTR region to act as a potent negative regulator of heterologous gene expression and support the notion that the bradykinin B2 3'-UTR may impact endogenous receptor regulation.
15894833 Observational study of gene-disease association. (HuGE Navigator)
15894833 polymorphism (-58 T/C) in the promoter region of BDKRB might be a risk factor and might have a synergetic effect with the ACE for LVH in hypertensives, but it is not associated with hypertension in the Japanese population
15805101 bradykinin receptors in inflammatory bowel disease may reflect intestinal inflammation
15771553 Observational study of gene-disease association. (HuGE Navigator)
15771553 B2R polymorphism has a potential role in the earlier development of chronic renal failure in susceptible individuals.
15664665 study shows that bradykinin upregulates IL-1beta- and TNFalpha-stimulated IL-8 production via BK B2 receptor and that PKC signal pathway seems to be involved in the upregulation of the cytokine-induced IL-8 production in gingival fibroblasts
15654972 kinins may affect the life span of human keratinocytes via BK2 activation
15643126 Observational study of gene-disease association. (HuGE Navigator)
15643125 Observational study of gene-disease association. (HuGE Navigator)
15643125 the two bradykinin receptors may play a role in blood pressure regulation
15634338 slow internalization of B(1)KB(2) was also accompanied by a lack of agonist-induced phosphorylation, that in contrast was observed for B(1)YB(2) and B(1)CB(2), suggesting that putative helix 8 is either directly or indirectly involved
15301669 Observational study of gene-disease association. (HuGE Navigator)
15281091 BK has mitogenic actions in cultured human epithelial breast cells; the activation of PKC-delta through B2 receptor acts in concert with ERK and PI3K pathways to induce cell proliferation.
15161928 Y305A mutation induces a receptor conformation which is prone to ligand-independent phosphorylation and internalization. The mutated receptor binds to, but does not activate, its cognate heterotrimeric G protein G(q/11).
15117835 AT2 receptor-mediated vasodilation in the human heart is mediated by B2 receptors.
15114524 Observational study of gene-disease association. (HuGE Navigator)
15114524 the C-58T B2R gene polymorphism is not associated with different levels of insulin resistance within a population of obese patients.
15112434 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15033977 B1 and B2 bradykinin receptors form a complex with enhanced signaling capacity
14607851 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14499231 Observational study of gene-disease association. (HuGE Navigator)
12851878 Bradykinin is a powerful spasmogen via B(2) receptor activation in the normal and, especially, in the inflamed human gallbladder.
12705334 Observational study of genetic testing. (HuGE Navigator)
12640257 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12522467 Observational study of gene-disease association. (HuGE Navigator)
12522467 Susceptibility to develop cough is associated with a genetic variant of the bradykinin B2 receptor promoter.
12489797 elevated level of BK found in tissue injury,is one of the major risk factors for development of Alzheimer's disease
12481150 Observational study of gene-disease association. (HuGE Navigator)
12450400 B2R is constitutively targeted to caveolae-related lipid rafts in HEK293 cells and appears to shuttle the agonist through these domains, whereas B1R may be there by default.
12130679 the C-terminal domain participates intimately in the efficacy of B1R and B2R G(q/11) coupling by contributing both positive and negative regulatory epitopes.
12107246 Observational study of gene-disease association. (HuGE Navigator)
12107246 Blood pressure in patients with primary aldosteronism is influenced by bradykinin B(2) receptor polymorphism.
12063092 Bradykinin B2 receptors are upregulated by inflammatory stimuli in bronchial epithelial cells.
12039525 Observational study of gene-disease association. (HuGE Navigator)
12039525 Exon 1 polymorphism of the B2BKR gene does not influence the clinical status of patients with hereditary angioedema.
12025967 Observational study of gene-disease association. (HuGE Navigator)
12025967 Bradykinin B2 receptor exon 1 polymorphism may represent a susceptibility marker for nephropathy progression in diabetic patients.
11954665 presence of B2R was studied in uteri obtained in luteal phase and in idiopathic pregnancy loss as well as in preterm and term pregnancies
11908480 Bradykinin can also induce antimitogenic effects using an alternative signal transduction pathway for the B2 receptor.
11747451 Two cysteine residues located in the carboxyterminal domain of the bradykinin B2 receptor are palmitoylated and play a critical role in the response of the receptor to ligand binding.
11710536 B1 and B2 receptor expression was enhanced in tumor cells and tissue adjacent to gastric cancer compared with gastric ulcers.
11699055 Observational study of gene-disease association. (HuGE Navigator)
11517947 Observational study of gene-disease association. (HuGE Navigator)
11446495 Observational study of gene-disease association. (HuGE Navigator)
11409654 Observational study of gene-disease association. (HuGE Navigator)
11324803 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQPPFLWVLFVL      1 - 70
ATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNNFDWLFGETLCRVVNAIISMN     71 - 140
LYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLVIWGCTLLLSSPMLVFRTMKEYSDEGHNVTA    141 - 210
CVISYPSLIWEVFTNMLLNVVGFLLPLSVITFCTMQIMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFI    211 - 280
ICWLPFQISTFLDTLHRLGILSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGV    281 - 350
CQKGGCRSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ                                 351 - 391
//

Text Mined References (188)

PMID Year Title
26907838 2016 Effect of BDKRB2 Gene -9/+9 Polymorphism on Training Improvements in Competitive Swimmers.
26362411 2016 Association of the bradykinin receptors genes variants with hypertension: a case-control study and meta-analysis.
26360782 2015 Bradykinin inhibits oxidative stress-induced senescence of endothelial progenitor cells through the B2R/AKT/RB and B2R/EGFR/RB signal pathways.
26235941 2015 Enhanced Ca(2+) response and stimulation of prostaglandin release by the bradykinin B2 receptor in human retinal pigment epithelial cells primed with proinflammatory cytokines.
25970620 2015 Involvement of B2 receptor in bradykinin-induced proliferation and proinflammatory effects in human nasal mucosa-derived fibroblasts isolated from chronic rhinosinusitis patients.
25842860 [[Length polymorphism of minisatellite repeat B2-VNTR of the bradykinin B2 receptor gene in healthy Russians and in patients with coronary heart disease].
25713410 2015 Close association of B2 bradykinin receptors with P2Y2 ATP receptors.
25641172 2015 The influence of angiotensin converting enzyme and bradykinin receptor B2 gene variants on voluntary fluid intake and fluid balance in healthy men during moderate-intensity exercise in the heat.
25529519 2014 The relationship of Bradykinin B? receptor gene variation with obesity, hypertension and lipid variables in obese patients.
25289859 2015 Downregulation of kinin B1 receptor function by B2 receptor heterodimerization and signaling.
25109623 2014 Bradykinin stimulates IL-6 production and cell invasion in colorectal cancer cells.
25078958 2013 The -9/+9 polymorphism of the bradykinin receptor Beta 2 gene and athlete status: a study involving two European cohorts.
24401952 2014 Differential gene expression of bradykinin receptors 1 and 2 in peripheral monocytes from patients with essential hypertension.
24304135 2014 Bradykinin B1 receptor-mediated vasodilation is impaired in myometrial arteries from women with pre-eclampsia.
24236827 2014 Trabecular meshwork bradykinin receptors: mRNA levels, immunohistochemical visualization, signaling processes pharmacology, and linkage to IOP reduction.
24211782 2014 Nuclear localization of bradykinin B(2) receptors reflects binding to the nuclear envelope protein lamin C.
24047499 2013 Bradykinin-induced Ca2+ signaling in human subcutaneous fibroblasts involves ATP release via hemichannels leading to P2Y12 receptors activation.
23805043 2013 Protein expression, biochemical pharmacology of signal transduction, and relation to intraocular pressure modulation by bradykinin B? receptors in ciliary muscle.
23730990 2013 Association of B2 receptor polymorphisms and ACE activity with ACE inhibitor-induced angioedema in black and mixed-race South Africans.
23613132 2013 Vascular reactivity and ACE activity response to exercise training are modulated by the +9/-9 bradykinin B? receptor gene functional polymorphism.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
23588115 2013 Bradykinin-induced asthmatic fibroblast/myofibroblast activities via bradykinin B2 receptor and different MAPK pathways.
23454239 2013 Inhibitory effects of cytoskeleton disrupting drugs and GDP-locked Rab mutants on bradykinin B? receptor cycling.
23428345 2013 MAPK/NF-?B-dependent upregulation of kinin receptors mediates airway hyperreactivity: a new perspective for the treatment.
23362199 2013 Clinical impact of an angiotensin I-converting enzyme insertion/deletion and kinin B2 receptor +9/-9 polymorphisms in the prognosis of renal transplantation.
23351078 2013 IL-4 and IL-13 inhibit IL-1? and TNF-? induced kinin B1 and B2 receptors through a STAT6-dependent mechanism.
23275384 2013 Novel insights into the critical role of bradykinin and the kinin B2 receptor for vascular recruitment of circulating endothelial repair-promoting mononuclear cell subsets: alterations in patients with coronary disease.
23243416 2012 BDKRB2 +9/-9 polymorphism is associated with higher risk for diabetes mellitus in the Brazilian general population.
23224295 2013 Functional and molecular characterization of kinin B1 and B 2 receptors in human bladder cancer: implication of the PI3K? pathway.
23176367 2012 Association of genome variations in the renin-angiotensin system with physical performance.
23132855 2012 Kinin-B2 receptor activity determines the differentiation fate of neural stem cells.
23127247 2012 Bradykinin type 2 receptor -9/-9 genotype is associated with triceps brachii muscle hypertrophy following strength training in young healthy men.
23093849 2012 The effect of bradykinin B2 receptor polymorphisms on the susceptibility and severity of osteoarthritis in a Chinese cohort.
22935637 2012 Bradykinin- and lipopolysaccharide-induced bradykinin B2 receptor expression, interleukin 8 release and "nitrosative stress" in bronchial epithelial cells BEAS-2B: role for neutrophils.
22900090 2012 Bradykinin ?2 receptor -58T/C gene polymorphism and essential hypertension: a meta-analysis.
22706620 2013 eNOS and BDKRB2 genotypes affect the antihypertensive responses to enalapril.
22706224 2012 Expression patterns of kinin-dependent genes in endometrial cancer.
22653778 2013 Bradykinin enhances cell migration in human prostate cancer cells through B2 receptor/PKC?/c-Src dependent signaling pathway.
22468762 2012 Association and interaction of -58C>T and ±9 bp polymorphisms of BDKRB2 gene causing susceptibility to essential hypertension.
22304584 2012 A capillary electrophoresis method for genotyping the 9-bp exon 1 insertion/deletion in BDKRB2.
22108573 2012 Prolonged signalling and trafficking of the bradykinin B2 receptor stimulated with the amphibian peptide maximakinin: insight into the endosomal inactivation of kinins.
22047990 2012 Bradykinin enhances Sindbis virus infection in human brain microvascular endothelial cells.
22016392 2011 Helix 8 plays a crucial role in bradykinin B(2) receptor trafficking and signaling.
21986469 2012 Downregulation of Bradykinin type 2 receptor expression in cardiac endothelial cells during senescence.
21871009 2011 Fever-like temperature modification differentially affects in vitro signaling of bradykinin B(1) and B(2) receptors.
21719759 2011 Arteriogenesis is modulated by bradykinin receptor signaling.
21626144 2011 Up-regulation of bradykinin B2 receptor by Pseudomonas aeruginosa via the NF-?B pathway.
21602894 2011 IRX1 influences peritoneal spreading and metastasis via inhibiting BDKRB2-dependent neovascularization on gastric cancer.
21600887 2011 A cleavable signal peptide enhances cell surface delivery and heterodimerization of Cerulean-tagged angiotensin II AT1 and bradykinin B2 receptor.
21586566 2011 High molecular weight kininogen activates B2 receptor signaling pathway in human vascular endothelial cells.
21451024 2011 Bradykinin promotes the chemotactic invasion of primary brain tumors.
21210858 2011 Is there an interaction between BDKRB2 -9/+9 and GNB3 C825T polymorphisms and elite athletic performance?
21145390 2011 Role of ßarrestins in bradykinin B2 receptor-mediated signalling.
21108627 2011 Comparison of the molecular interactions of two antagonists, MEN16132 or icatibant, at the human kinin B? receptor.
21052031 2011 Identification of genetic factors associated with susceptibility to angiotensin-converting enzyme inhibitors-induced cough.
20952631 2010 Association of single-nucleotide polymorphisms from 17 candidate genes with baseline symptom-limited exercise test duration and decrease in duration over 20 years: the Coronary Artery Risk Development in Young Adults (CARDIA) fitness study.
20944660 2011 SNP-by-fitness and SNP-by-BMI interactions from seven candidate genes and incident hypertension after 20 years of follow-up: the CARDIA Fitness Study.
20856803 2010 Cardiovascular risk associated with interactions among polymorphisms in genes from the renin-angiotensin, bradykinin, and fibrinolytic systems.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602751 2010 Generalist genes analysis of DNA markers associated with mathematical ability and disability reveals shared influence across ages and abilities.
20592051 2010 Interactions among related genes of renin-angiotensin system associated with type 2 diabetes.
20511677 2010 No association between alleles of the bradykinin receptor-B2 gene and acute mountain sickness.
20473401 2010 Establishment of an in vivo model facilitates B2 receptor protein maturation and heterodimerization.
20300066 2010 Genetic influence on baroreflex sensitivity in normotensive young men.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20189583 2011 Remote ischemic preconditioning stimulus decreases the expression of kinin receptors in human neutrophils.
20050188 2009 Novel effects mediated by bradykinin and pharmacological characterization of bradykinin B2 receptor antagonism in human synovial fibroblasts.
20045189 2010 Distribution and expression of B2-kinin receptor on human leukocyte subsets in young adults and elderly using flow cytometry.
20044476 2010 Associations of polymorphisms of eight muscle- or metabolism-related genes with performance in Mount Olympus marathon runners.
20036225 2010 A meta-analysis of the bradykinin B2 receptor gene --58C/T polymorphism with hypertension.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19885862 2010 Bradykinin enhances cell migration in human chondrosarcoma cells through BK receptor signaling pathways.
19854233 2010 Human astrocytic bradykinin B(2) receptor modulates zymosan-induced cytokine expression in 1321N1 cells.
19744011 2009 Lack of association between ACE and bradykinin B2 receptor gene polymorphisms and ACE inhibitor-induced coughing in hypertensive Koreans.
19725054 2009 Both B1R and B2R act as intermediate signaling molecules in high glucose-induced stimulation of glutamate uptake in ARPE cells.
19716087 2009 Genetic variation in angiotensin-converting enzyme-related pathways associated with sudden cardiac arrest risk.
19628666 2009 Endogenous bradykinin contributes to increased plasminogen activator inhibitor 1 antigen following hemodialysis.
19580784 2009 Calreticulin enhances B2 bradykinin receptor maturation and heterodimerization.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19565561 2009 Hypoxia-induced expression of bradykinin type-2 receptors in endothelial cells triggers NO production, cell migration, and angiogenesis.
19456859 2009 Alanine screening of the intracellular loops of the human bradykinin B receptor--effects on receptor maintenance, G protein activation and internalization.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19404481 2009 Immunohistochemical localization of the bradykinin B1 and B2 receptors in human nasal mucosa.
19339996 2009 Insertion/deletion polymorphism of the bradykinin type 2 receptor gene influence diastolic blood pressure.
19120546 2008 Expression of genes encoding kinin receptors in peripheral blood mononuclear cells from patients with acute coronary syndromes.
19110485 2009 Genetic risk factors in typical haemolytic uraemic syndrome.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19082699 2009 The rationale and design of the PERindopril GENEtic association study (PERGENE): a pharmacogenetic analysis of angiotensin-converting enzyme inhibitor therapy in patients with stable coronary artery disease.
19074839 2008 Kinin b2 receptor mediates induction of cyclooxygenase-2 and is overexpressed in head and neck squamous cell carcinomas.
19038786 2009 Expression of kinin receptors on eosinophils: comparison of asthmatic patients and healthy subjects.
19017652 2009 Lack of evidence for AT1R/B2R heterodimerization in COS-7, HEK293, and NIH3T3 cells: how common is the AT1R/B2R heterodimer?
18938142 2009 Identification of functional bradykinin B(2) receptors endogenously expressed in HEK293 cells.
18927465 2008 Role of kinin B2 receptor signaling in the recruitment of circulating progenitor cells with neovascularization potential.
18810490 2009 The bradykinin B2 receptor in the early immune response against Listeria infection.
18672896 2008 Regulation of G protein-coupled receptor activities by the platelet-endothelial cell adhesion molecule, PECAM-1.
18577888 2008 Influence of the kallikrein-kinin system on prostate and breast tumour angiogenesis.
18467203 2008 Kinin B1 and B2 receptor expression in osteoblasts and fibroblasts is enhanced by interleukin-1 and tumour necrosis factor-alpha. Effects dependent on activation of NF-kappaB and MAP kinases.
18430865 2008 Kinin B2 receptor-mediated bradykinin internalization and metalloendopeptidase EP24.15-dependent intracellular bradykinin degradation.
18258629 2008 Vitamin D receptor genotypes influence quadriceps strength in chronic obstructive pulmonary disease.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18187413 2008 Carboxypeptidase M and kinin B1 receptors interact to facilitate efficient b1 signaling from B2 agonists.
18180402 2008 Bradykinin type 2 receptor BE1 genotype influences bradykinin-dependent vasodilation during angiotensin-converting enzyme inhibition.
18096516 2008 Functional role of the conserved proline in helix 6 of the human bradykinin B2 receptor.
18039523 2007 Comparison of kinin B(1) and B(2) receptor expression in neutrophils of asthmatic and non-asthmatic subjects.
17852785 2007 Gene expression of kinin receptors B1 and B2 in PBMC from patients with cardiac syndrome X.
17593394 2007 The effects of polymorphisms in genes from the renin-angiotensin, bradykinin, and fibrinolytic systems on plasma t-PA and PAI-1 levels are dependent on environmental context.
17569300 [Endothelin 1 and angiotensin II in preeeclampsia].
17522594 2008 The bradykinin type 2 receptor BE1 polymorphism and ethnicity influence systolic blood pressure and vascular resistance.
17420253 2007 Signaling through a G Protein-coupled receptor and its corresponding G protein follows a stoichiometrically limited model.
17363739 2007 CD13/APN regulates endothelial invasion and filopodia formation.
17328065 2007 Bradykinin potentiates cytokine-induced prostaglandin biosynthesis in osteoblasts by enhanced expression of cyclooxygenase 2, resulting in increased RANKL expression.
17327486 2007 Expression of kinin B1 and B2 receptors in immature, monocyte-derived dendritic cells and bradykinin-mediated increase in intracellular Ca2+ and cell migration.
17303584 2007 Study of candidate genes affecting the progression of renal disease in autosomal dominant polycystic kidney disease type 1.
17299793 2007 Angiotensin II type 1 and bradykinin B2 receptors expressed in early stage epithelial cells derived from human embryonic stem cells.
17207964 2007 Epistatic effects of polymorphisms in genes from the renin-angiotensin, bradykinin, and fibrinolytic systems on plasma t-PA and PAI-1 levels.
17110500 2007 Kinins promote B2 receptor endocytosis and delay constitutive B1 receptor endocytosis.
17077303 2006 Human ACE and bradykinin B2 receptors form a complex at the plasma membrane.
17030791 2006 G protein-coupled receptors sense fluid shear stress in endothelial cells.
16950802 2006 Dipsogenic genes associated with weight changes during Ironman Triathlons.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16740128 2006 Biochemical and pharmacological characterization of the human bradykinin subtype 2 receptor produced in mammalian cells using the Semliki Forest virus system.
16600946 2006 +9/+9 Homozygosity of the bradykinin receptor gene polymorphism is associated with reduced fat-free mass in chronic obstructive pulmonary disease.
16489763 2006 Human bradykinin B2 receptor sialylation and N-glycosylation participate with disulfide bonding in surface receptor dimerization.
16461337 2006 The bradykinin beta 2 receptor (BDKRB2) and endothelial nitric oxide synthase 3 (NOS3) genes and endurance performance during Ironman Triathlons.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16294326 2006 Microarray and phosphokinase screenings leading to studies on ERK and JNK regulation of connective tissue growth factor expression by angiotensin II 1a and bradykinin B2 receptors in Rat1 fibroblasts.
16263113 2005 Optical biosensor provides insights for bradykinin B(2) receptor signaling in A431 cells.
16144969 2006 3'-Untranslated region of the type 2 bradykinin receptor is a potent regulator of gene expression.
15894833 2004 Relationship of bradykinin B2 receptor gene polymorphism with essential hypertension and left ventricular hypertrophy.
15805101 2005 Immunolocalization and expression of kinin B1R and B2R receptors in human inflammatory bowel disease.
15771553 2004 Association of the human bradykinin B2 receptor gene with chronic renal failure.
15664665 2005 Bradykinin upregulates IL-8 production in human gingival fibroblasts stimulated by interleukin-1beta and tumor necrosis factor alpha.
15654972 2005 Kinin B2 receptor-coupled signal transduction in human cultured keratinocytes.
15643126 2005 Bradykinin B2 receptor gene (-58T/C) polymorphism influences baroreflex sensitivity in never-treated hypertensive patients.
15643125 2005 Sequence variation of bradykinin receptors B1 and B2 and association with hypertension.
15634338 2005 The role of helix 8 and of the cytosolic C-termini in the internalization and signal transduction of B(1) and B(2) bradykinin receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15301669 2004 Lack of association of a 9 bp insertion/deletion polymorphism within the bradykinin 2 receptor gene with myocardial infarction.
15281091 2004 Mitogenic signalling by B2 bradykinin receptor in epithelial breast cells.
15161928 2004 Mutation of tyrosine in the conserved NPXXY sequence leads to constitutive phosphorylation and internalization, but not signaling, of the human B2 bradykinin receptor.
15117835 2004 Angiotensin II type 2 receptor-mediated vasodilation in human coronary microarteries.
15114524 2004 Bradykinin B2 receptor gene C-58T polymorphism and insulin resistance. A study on obese patients.
15112434 2004 [Impact of angiotensin-converting enzyme, angiotensinogen, endothelial NO synthase, and bradykinin receptor B2 gene polymorphisms on myocardium in patients with hypertension and in athletes].
15033977 2004 Spontaneous formation of a proteolytic B1 and B2 bradykinin receptor complex with enhanced signaling capacity.
14607851 2004 Bradykinin receptor gene variant and human physical performance.
14499231 2003 Variation in bradykinin receptor genes increases the cardiovascular risk associated with hypertension.
12851878 2003 Bradykinin B2 receptors mediate contraction in the normal and inflamed human gallbladder in vitro.
12705334 2003 Rapid and reliable genotyping of the C181T polymorphism in the bradykinin B2 receptor gene.
12640257 2003 B2 bradykinin receptor (B2BKR) polymorphism and change in left ventricular mass in response to antihypertensive treatment: results from the Swedish Irbesartan Left Ventricular Hypertrophy Investigation versus Atenolol (SILVHIA) trial.
12522467 2002 Association of polymorphisms of the renin-angiotensin system and bradykinin B2 receptor with ACE-inhibitor-related cough.
12489797 2002 Bradykinin receptor modulation in cellular models of aging and Alzheimer's disease.
12481150 Polymorphic genes for kinin receptors, nephropathy and blood pressure in type 2 diabetic patients.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12450400 2002 Human B1 and B2 bradykinin receptors and their agonists target caveolae-related lipid rafts to different degrees in HEK293 cells.
12177051 2002 A novel protein-protein interaction between a G protein-coupled receptor and the phosphatase SHP-2 is involved in bradykinin-induced inhibition of cell proliferation.
12130679 2002 Negative and positive regulatory epitopes in the C-terminal domains of the human B1 and B2 bradykinin receptor subtypes determine receptor coupling efficacy to G(q/11)-mediated [correction of G(9/11)-mediated] phospholipase Cbeta activity.
12107246 2002 Blood pressure in patients with primary aldosteronism is influenced by bradykinin B(2) receptor and alpha-adducin gene polymorphisms.
12063092 2002 Regulation of kinin receptors in airway epithelial cells by inflammatory cytokines and dexamethasone.
12039525 2002 Exon 1 polymorphism of the B2BKR gene does not influence the clinical status of patients with hereditary angioedema.
12025967 2002 Bradykinin B2 receptor gene polymorphism is associated with altered urinary albumin/creatinine values in diabetic patients.
11710536 2001 Comparison of tissue kallikrein and kinin receptor expression in gastric ulcers and neoplasms.
11699055 2001 Angiotensin-converting enzyme gene insertion/deletion, not bradykinin B2 receptor -58T/C gene polymorphism, associated with angiotensin-converting enzyme inhibitor-related cough in Chinese female patients with non-insulin-dependent diabetes mellitus.
11517947 2001 Polymorphisms in the bradykinin B2 receptor gene and childhood asthma.
11517230 2001 Determination of bradykinin B2 receptor in vivo phosphorylation sites and their role in receptor function.
11446495 2001 The genetic factor in acute myocardial infarction with hypertension.
11409654 2001 Genetic variation in the promoter region of the beta2 bradykinin receptor gene is associated with essential hypertension in a Chinese Han population.
11324803 2001 Genetic background in patients with acute myocardial infarction.
10993080 2000 AT1-receptor heterodimers show enhanced G-protein activation and altered receptor sequestration.
10748135 2000 Replacement of the transmembrane anchor in angiotensin I-converting enzyme (ACE) with a glycosylphosphatidylinositol tail affects activation of the B2 bradykinin receptor by ACE inhibitors.
10681501 2000 Interaction of endothelial and neuronal nitric-oxide synthases with the bradykinin B2 receptor. Binding of an inhibitory peptide to the oxygenase domain blocks uncoupled NADPH oxidation.
10653985 2000 Regulation of the human bradykinin B2 receptor expressed in sf21 insect cells: a possible role for tyrosine kinases.
10510297 1999 Endothelial nitric oxide synthase interactions with G-protein-coupled receptors.
10469138 1999 Human chemokine receptors CCR5, CCR3 and CCR2B share common polarity motif in the first extracellular loop with other human G-protein coupled receptors implications for HIV-1 coreceptor function.
10188626 1999 Two B1 and B2 bradykinin receptor antagonists fail to inhibit the Ca2+ response elicited by bradykinin in human skin fibroblasts.
10085087 1999 Correlations in palmitoylation and multiple phosphorylation of rat bradykinin B2 receptor in Chinese hamster ovary cells.
8900488 1996 Protein kinases A and C rapidly modulate expression of human lung fibroblast B2 bradykinin receptor affinity forms.
8777990 1996 Bradykinin enhances GLUT4 translocation through the increase of insulin receptor tyrosine kinase in primary adipocytes: evidence that bradykinin stimulates the insulin signalling pathway.
8652530 1996 Structure of the bradykinin B2 receptors' amino terminus.
8394991 1993 Cloned murine bradykinin receptor exhibits a mixed B1 and B2 pharmacological selectivity.
8302267 1994 Differential pharmacology of cloned human and mouse B2 bradykinin receptors.
8063797 1994 Expression cloning of a human B1 bradykinin receptor.
7916737 1993 Human bradykinin B2 receptor: nucleotide sequence analysis and assignment to chromosome 14.
7835885 1994 Structure and chromosomal localization of the gene (BDKRB2) encoding human bradykinin B2 receptor.
7779090 1995 Identification of polymorphic sites of the human bradykinin B2 receptor gene.
7779089 1995 The human bradykinin B2 receptor gene: full length cDNA, genomic organization and identification of the regulatory region.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.
1329734 1992 Molecular cloning, functional expression and pharmacological characterization of a human bradykinin B2 receptor gene.
1314587 1992 Cloning and pharmacological characterization of a human bradykinin (BK-2) receptor.