Property Summary

Ligand Count 413
NCBI Gene PubMed Count 94
PubMed Score 132.61
PubTator Score 236.75

Knowledge Summary

Patent (8,761)

Expression

Protein-protein Interaction (1)

Gene RIF (78)

AA Sequence

MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLLVFLLPRRQLN      1 - 70
VAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKANLFISIFLVVAISQDRYRVLV     71 - 140
HPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQAVPDLNITACILLLPHEAWHFARIVELNILG    141 - 210
FLLPLAAIVFFNYHILASLRTREEVSRTRCGGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQA    211 - 280
VRGCFWEDFIDLGLQLANFFAFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLF    281 - 350
WRN                                                                       351 - 353
//

Text Mined References (95)

PMID Year Title