Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.82
PubTator Score 8.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Gonorrhea 14 3.011 1.5

Expression

Synonym

Accession Q9BUT1 A8K295 B4DUF6 Q503A0 Q6IA46 Q6UWD3 Q9H8S8 Q9NRX8
Symbols DHRS6
EFA6R
SDR15C1
UCPA-OR
UNQ6308
PRO20933

Gene

PDB

2AG5  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

PMID Text
25762501 intracellular expression in macrophages is downregulated by stress and inflammation
23941109 BDH2 expression is an independent poor prognostic factor for CN-AML, with an anti-apoptotic role. Patients with high BDH2 expression have relatively shorter overall survival and a low complete response rate.
22527885 Iron-mediated post-transcriptional regulation of hBDH2 controls mitochondrial iron homeostasis in human cells.
21791085 Data show that the ketone body metabolizing enzymes BDH1, BDH2, OXCT1 and ACAT1 were expressed at the mRNA and protein level in all glioma cell lines.
20332099 Observational study of gene-disease association. (HuGE Navigator)
16380372 DHRS6 is an orphan short chain dehydrogenase/ reductase enzyme

AA Sequence

MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQTRVLDVTKKKQIDQFAN      1 - 70
EVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVASSVKG     71 - 140
VVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGR    141 - 210
FATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL                                       211 - 245
//

Text Mined References (18)

PMID Year Title
25762501 2014 Inflammation and ER stress downregulate BDH2 expression and dysregulate intracellular iron in macrophages.
23941109 2013 Human BDH2, an anti-apoptosis factor, is a novel poor prognostic factor for de novo cytogenetically normal acute myeloid leukemia.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22527885 2012 Siderophore-mediated iron trafficking in humans is regulated by iron.
21791085 2011 Differential utilization of ketone bodies by neurons and glioma cell lines: a rationale for ketogenic diet as experimental glioma therapy.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21269460 2011 Initial characterization of the human central proteome.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
16380372 2006 Characterization of human DHRS6, an orphan short chain dehydrogenase/reductase enzyme: a novel, cytosolic type 2 R-beta-hydroxybutyrate dehydrogenase.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.