Property Summary

NCBI Gene PubMed Count 336
PubMed Score 896.05
PubTator Score 560.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 2.000 1.3e-04
osteosarcoma -1.388 1.3e-02
atypical teratoid / rhabdoid tumor -1.600 2.5e-03
medulloblastoma, large-cell -1.300 1.6e-03
intraductal papillary-mucinous adenoma (... 1.600 5.0e-04
subependymal giant cell astrocytoma -1.266 1.5e-02
ovarian cancer 1.700 2.0e-05

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652149 confirmatory 0 / 0 / 47 Biochemical RhoGAP selectivity assay - BCR GAP

Gene RIF (257)

PMID Text
27273956 BCR-ABL1 transcript types found in Syria were similar to that of Indian Far-Eastern, African or European populations. The M-BCR rearrangement types were not dependent on white blood count, platelet count, hemoglobin level or gender of the patients.
26831735 Data suggest elevated interleukin-1beta secretion from tyrosine kinase inhibitor- (TKI-)resistant chronic myeloid leukemia (CML) cells contributes to TKI/imatinib resistance via promotion of cell viability/migration; cells used lack BCR-ABL mutation.
26721204 Blockade of the interaction between Bcr-Abl and PTB1B by small molecule SBF-1 to overcomes imatinib-resistance of K562 cells.
26607903 Suggest that AIC-47 in combination with imatinib strengthened the attack on cancer energy metabolism in BCR-ABL-harboring leukemic cells.
26429162 analysis of WT1 and M-BCR-ABL expressions in chronic myeloid leukemia reveals that high WT1 expression in CML patients is detected especially in the advanced stages of the disease
26295305 Identify a novel BCR-ABL/IkappaBalpha/p53 network, whereby BCR-ABL functionally inactivates a key tumor suppressor in chronic myeloid leukemia.
26291129 demonstrated that depletion of endogenous MAPK15 expression inhibited BCR-ABL1-dependent cell proliferation
26264145 Higher incidence of BCR-ABL and lower incidence of TEL-AML1 are associated with acute lymphoblastic leukemia.
26252834 Molecular rearrangements and the minimal residual disease follow-up for 5 chronic myeloid leukaemia patients; 3 resulted from new rearrangements between the BCR and ABL1 sequences (the breakpoints being located within BCR exon 13 in 2 cases and within BCR exon 18 in one case). The other 2 cases revealed a complex e8-[ins]-a2 fusion transcript involving a 3rd partner gene.
26186983 Data sugget that the acquisition of additional BCR-ABL1 fusion genes in chronic myeloid leukemia (CML) in the blast phase (BP) through mitotic recombination between the derivative chromosome and the normal homologue.
26179066 we describe a regulatory pathway modulating BCR and BCR/ABL1 expression, showing that the BCR promoter is under the transcriptional control of the MYC/MAX heterodimer.
26087013 Separase protein levels decrease and Separase proteolytic activity increases exclusively in b3a2 p210BCR-ABL-positive cell lines under Imatinib treatment.
25876659 alpha4 is an important regulatory molecule of apoptosis and Bcl-xL phosphorylation induced by BCR crosslinking.
25769542 Expression profiling of adult acute lymphoblastic leukemia identifies a BCR-ABL1-like subgroup characterized by high non-response and relapse rates.
25756742 our results confirm that not obtaining a BCR-ABL/ABL ratio of </=10% at 3 months is a warning sign because it compromises the potential response to treatment even when switching to a 2GTKI.
25740611 BCR- ABL1 mutations are associated with the clinical resistance, but may not be considered the only cause of resistance to imatinib.
25730044 expression of the BCR-ABL gene were confirmed by FISH, which revealed a high concordance (100%) rate. We found that real-time RT-qPCR is more reliable and should be used in Moroccan biomedical analysis laboratories to monitor CML progression
25721898 BCR-ABL1 mutation is associated with chronic myeloid leukemia.
25648025 Leptin levels were increased in BCR-ABL p210 positive chronic myeloid leukemia patients.
25644089 AIC-47, acting through the PPARgamma/beta-catenin pathway, induced down-regulation of c-Myc, leading to the disruption of the bcr-abl/mTOR/hnRNP signaling pathway, and switching of the expression of PKM2 to PKM1 in acute myeloid leukemia.
25631082 Bcr knockdown in the context of KSHV-associated disease might enhance Rac1-mediated angiogenesis.
25615000 Lack of response to tyrosine kinase inhibitors associated with mutation in the BCR-ABL gene was significantly higher in imatinib-treated patients, and all mutations arose after treatment. T315I was a common treatment-emergent mutation
25520136 High proportion of M-bcr gene is associated with chronic myeloid leukemia.
25479544 Results suggest that the EGFR and Akt pathways are involved in regulation of BCRP expression in non small cell lung carcinoma cells.
25379619 BCR-ABL kinase domain mutation is associated with Philadelphia-positive leukemia.
25293778 BCR-ABL1 kinase-dependent and -independent mechanisms convert p27 from a nuclear tumor suppressor to a cytoplasmic oncogene.
25217883 BCR-ABL-T315I mutation is associated with chronic myeloid leukemia.
25213664 The epigenetic silencing of miR-23a led to derepression of BCR/ABL expression, and consequently contributes to CML development and progression.
25134459 STAT3 is a critical signaling node in BCR-ABL1 tyrosine kinase-independent leukemia resistance that is reversed by a discovered BP-5-087.
25132497 BCR-ABL1 compound mutants confer different levels of tyrosine kinase inhibitor resistance, necessitating rational treatment selection to optimize clinical outcome.
24998540 High BCR/ABL mRNA expression is associated with chronic myeloid leukemia.
24967705 ATRA treatment decreased DNA damage repair and suppressed acquisition of BCR-ABL mutations
24903628 Findings show that residual Ph(+) cells are low BCR-ABL1 producers, and that DNA-based methods are required to assess the content of persisting Ph(+) stem cells in these patients.
24856998 Co-expression of EVI1 and BCR/ABL fusion gene can be found in childhood CML and ALL.
24836440 Although BCR-ABL induces STAT5-tyrosine phosphorylation independent of JAK2-kinase activity, BCR-ABL is less efficient in inducing active STAT5A:STAT5B-heterodimerization than IL-3.
24779036 This study confirms the presence at diagnosis of the BCR-ABL1 fusion gene in myeloid cell lineages from CML patients,including also in a significant fraction of cases, a smaller percentage of T, B, and NK lymphocytes.
24675360 The kinase activity of BCR-ABL upregulates ST2 cell surface expression on CD34(+) cells from patients with CML-CP.
24550512 Molecular dynamics reveal BCR-ABL1 polymutants as a unique mechanism of resistance to PAN-BCR-ABL1 kinase inhibitor therapy.
24487968 C817 is a promising compound for treatment of CML patients with Bcr-Abl kinase domain mutations that confer imatinib resistance.
24456693 Serial monitoring of BCR-ABL1 transcripts in chronic myeloid leukemia (CML) patients allows appropriate selection of CML patients for BCR-ABL1 kinase domain mutation analysis associated with acquired Tyrosine kinase inhibitors resistance.
24269846 Data indicate that BCR-ABL mRNA and phosphorylation of BCR protein were upregulated in K562/Adh cell.
24262285 Data show that factors associated with not attaining a major molecular response (MMR) were the presence of the minor BCR-ABL1 fusion gene, a low dose of tyrosine kinase inhibitor (TKI), and the kinase domain mutations conferring resistance to imatinib.
23980151 monobodies targeting the N-SH2 domain disrupted the interaction of SHP2 with its upstream activator, the Grb2-associated binder 2 adaptor protein, suggesting decoupling of SHP2 from the BCR-ABL protein complex
23974192 Higher cumulative incidence of relapse was found for BCR-ABL1-like and IKZF1-deleted, but not CRLF2-high, cases relative to remaining BCP-ALL cases.
23940119 The data identify the GEF Bcr as a regulator of RhoA/MAL signaling in keratinocytes, which in turn promotes differentiation through the desmosomal cadherin Dsg1.
23934627 Bcr-Abl activates AURKA and AURKB in chronic myeloid leukemia cells via AKT signaling.
23894305 A low level of expression of miR-196b can cause up-regulation of BCR-ABL1 and HOXA9 expression, which leads to the development of chronic myeloid leukemia.
23799845 The data suggest that some BCR-ABL1 mutations may persist at undetectable levels for many years after changing therapy, and can be reselected and confer resistance to subsequent inhibitors.
23788109 Silencing of both BCR-ABL siRNA and GFI1B siRNA is associated with an additive antileukemic effect against K562 cells.
23716543 The BCR-ABLT315I mutation has a significant negative impact on overall survival in chronic phase chronic myelogenous leukemia patients resistant to tyrosine kinase inhibitors.
23604228 BCR-ABL1 kinase mutations are associated with chronic myelogenous leukemia.
23588714 BCR-ABL1 breakpoints are associated with chronic myeloid leukemia.
23547655 Rapid initial decline in BCR-ABL1 is associated with superior responses to second-line nilotinib in patients with chronic-phase chronic myeloid leukemia.
23458731 Suggest the existence of a feed-forward loop accelerating chronic myeloid leukemia progression, in which BCR-ABL1 enhances its own mutation rate in a STAT5-reactive oxygen species dependent manner.
23428668 miR-29b may function as a tumor suppressor by targeting ABL1 and BCR/ABL1.
23396943 Insulin-specific 125Tg transgenic B cells support T cell-mediated type 1 diabetes in NOD mice, despite being anergic to B cell mitogens and T cell-dependent immunization.
23317202 High Frequency of BCR-ABL was associated with acute lymphoblastic leukemia.
23289360 The BCR-ABL1 T315I mutation is associated with tyrosine kinase inhibitor resistance and disease progression in patients with chronic myelogenous leukemia.
23287430 miR-30a acts as a tumor suppressor by downregulating ABL1 and BCR-ABL1 expression.
23277196 Studies indicate new generations of BCR-ABL kinase inhibitors and alternative targeting strategies for the effective treatment options for imatinib-resistant patients.
23269583 we report the frequencies of M-BCR-ABL fusion transcripts in 44 chronic myeloid leukemia patients
23223358 We conclude that compound mutations are common in patients with sequencing evidence for 2 BCR-ABL1 mutations and frequently reflect a highly complex clonal network.
23207522 RhoGEF activity of p210 BCR/ABL directly contributes to transforming activity, and may account for the difference in disease outcome associated with p190 BCR/ABL and p210 BCR/ABL.
23171834 A novel mRNA in-frame fusion between exon 4 of the breakpoint cluster region (BCR) gene at chromosome 22q11 and exon 9 of FGFR1 gene on chromosome 8p11-12 was identified by reverse transcription polymerase chain reaction
23124138 TC48 dephosphorylates BCR-Abl but not c-Abl and inhibits its activity towards its substrate.
23086624 V299L BCR-ABL kinase domain mutation is associated with response to therapy in chronic myelogenous leukemia.
23065514 the quantitative level of mutant T315I allele is predictive of major molecular response at 12 months on second-line nilotinib or dasatinib treatment.
23062378 study demonstrates kinetics of different BCR-ABL1 mutant emergence and an association between BCR-ABL1 mutations and progression of chronic myeloid leukemia
23062104 report of rare, concomitant occurrence of Janus kinase 2 V617F mutation with BCR-ABL (breakpoint cluster region--c-abl oncogene 1 fusion protein) translocation at presentation in five patients with atypical myeloproliferative neoplasm [CASE REPORT]
23047475 BCR-ABL1 kinase inhibits uracil DNA glycosylase UNG2 to enhance oxidative DNA damage and stimulate genomic instability in chronic myeloid leukemia.
22957062 Knocking down low molecular weight protein tyrosine phosphatase (LMW-PTP) reverts chemoresistance through inactivation of Src and Bcr-Abl proteins
22896000 BCR-ABL T315I mutation is associated with response to therapy in chronic myeloid leukemia.
22847163 case series examined the clinical, histopathologic, and genetic features of 3 patients with myeloproliferative neoplasms characterized by concomitant BCR-ABL1 translocation and JAK2(V617F)mutation
22787435 Bcr-Abl may critically requires tyrosine phosphorylation of SOCS-1 and SOCS-3 to mediate tumorigenesis when these SOCS proteins are present in cells.
22782217 TAT-CC fusion protein depresses the oncogenicity of BCR-ABL through interrupting its oligomerization.
22772060 Highly resistant BCR-ABL T315I mutation is associated with response to therapy in leukemia.
22665066 BCR-ABL is critically involved in the leukemia-specific expression of DR4 and DR5 and in the susceptibility of Ph(+) leukemia to TRAIL-mediated anti-leukemic activity.
22593461 qPCR detected a decrease of BCR-ABL to 190 copies once, but this suddenly increased to 22,000 copies
22591684 Src, Akt, NF-kappaB, BCL-2 and c-IAP1 may be involved in an anti-apoptotic effect in patients with BCR-ABL positive and BCR-ABL negative acute lymphoblastic leukemia.
22587422 Plasma BCR-ABL T315I kinase domain mutation is associated with drug resistance to dasatinib therapy for Philadelphia-positive acute lymphoid leukemia.
22526369 BCR-ABL1 transcript quantification was performed in 117 samples from chronic myeloid leukemia patients in two different laboratories by both methods, and the results were compared by statistical procedures.
22471662 Therapeutic targeting of BCR-ABL: prognostic markers of response and resistance mechanism in chronic myeloid leukaemia.
22447844 Data show that the cyclin-dependent kinase 7/9 inhibitor (CDK7/9 inhibitor) potently inhibits FIP1L1-PDGFRalpha-positive Bcr-Abl-positive chronic myeloid leukemia (CML) cells.
22384256 BCR-JAK2 codes for a protein containing the BCR oligomerization domain fused to the JAK2 tyrosine-kinase domain
22327125 Report use of bcr-abl-transformed mouse 12B1 cells secreting interleukin-2 and granulocyte-macrophage colony-stimulating factor as cancer vaccines.
22233112 BCR-ABL activity measured by 50% inhibitory concentration for imatinib, p-CrkL/CrkL ratio or p-CrkL ratio in CD34+ cells of patients with chronic myeloid leukemia does not predict treatment response
22231445 The results demonstrate a critical contribution of STAP-2 in BCR-ABL activity.
22230800 Bcr-abl kinase domain mutations during imatinib treatment are associated with recurrent bcr-abl positive acute lymphoblastic leukemia.
22184410 Data suggest that chronic myeloid leukemia stem cell survival is Bcr-Abl kinase independent and suggest curative approaches in CML must focus on kinase-independent mechanisms of resistance.
21960589 In childhood Ph(+) acute lymphoblastic leukemia, BCR-ABL1 gene fusion can be a prenatal and possibly initiating genetic event.
21935931 Bcr-Abl stimulates Jab1 expression via the cooperative interaction of beta-catenin and STAT1 in leukemia cells.
21908428 Data suggest that expression of FcRL4, which marks a distinct population of memory B-cells, is sufficient to dampen BCR signaling and to enhance TLR9 signaling.
21903771 Patients treated with imatinib exhibit a biphasic decrease in BCR-ABL transcript levels, with a rapid decrease during the first few months of treatment, followed by a more gradual decrease that often continues over many years.
21900237 CDK1-mediated phosphorylation of Abi1 attenuates Bcr-Abl-induced F-actin assembly and tyrosine phosphorylation of WAVE complex during mitosis
21895409 Mutations in the BCR-ABL kinase domain is associated with treatment response in chronic myeloid leukemia.
21764785 (18)F-SKI696 is taken up in vivo by tumors that overexpress Bcr-Abl
21762985 Low-level Bcr-Abl mutations are very rare in chronic myeloid leukemia patients who are in major molecular response on first-line nilotinib.
21693761 Identified are four patients with agammaglobulinemia and markedly reduced but detectable B cells in the peripheral circulation. These B cells have an unusual phenotype characterized by increased expression of CD19 but no BCR.
21674858 In 100 patients (73.5%) the b3a2 and in 34 (25%) the b2a2 forms of BCR-ABL were detected
21641753 TAT-CC-HA could interact with BCR-ABL in K562 cells
21504383 Data suggest that IM-associated cytopenias are associated with a high pre-IM percentage of BCR-ABL+ cells measured by FISH, are reversible, and do not adversely affect outcomes.
21489624 F317L BCR-ABL1 kinase domain mutation is associated with a sustained major molecular response in a chronic myeloid leukemia patient on dasatinib.
21330459 Data show that ITP-79 modulated binding of TG2 to fibronectin.
21310073 Breakpoint cluster region (Bcr) represents both an interacting partner under non-stressed conditions and a target of transglutaminase activity for Transglutaminase 2 (TG2) during extreme stress.
21266020 loss of the C-terminus of BCR-ABL1 is associated with significant resistance to kinase inhibitors
21248063 Ubiquitin-cycle inhibition represents a novel and effective approach to blocking Bcr-Abl kinase signaling and reducing Mcl-1 levels to engage chronic myelogenous leukemia cell apoptosis.
21239056 BCR-ABL1 mutations in patients with imatinib-resistant Philadelphia chromosome-positive leukemia.
21203397 there is a disruption of the FA/BRCA pathway in BCR/ABL cells
21183952 Bcr-Abl stability and oncogenic signaling in chronic myeloid leukemia (CML) cells are under the control of Jak2.
21156844 Allogeneic hematopoietic stem cell transplantation for chronic myelogenous leukemia patients who failed tyrosine kinase inhibitors after developing BCR-ABL1 kinase domain mutations.
21045136 Bcr-abl(delexon7) is frequently observed in CML patients when using sensitive techniques. It seems to be the result of an alternative splicing mechanism and to be independent from the occurrence of resistance.
20739956 BCR-ABL1 tyrosine kinase domain mutation is associated with primitive chronic myeloid leukemia.
20717963 Results suggest that Bcr-Abl increases Emi1 phosphorylation and stability to prevent Skp2 protein degradation via APC/Cdh1-induced ubiquitination and to enhance proliferation of CML cells.
20697350 modular and phosphorylation-driven interaction network provides a framework for the integration of pleiotropic signaling effects of BCR-ABL1 toward leukemic transformation
20633771 this is the first report of BCR-ABL1 transcript with breakpoint occurring within both BCR and ABL1 introns and fusion of intronic sequences from both BCR and ABL1 genes
20607847 BCR-ABL1 fusion gene mutations are associated with imatinib resistance in Philadelphia positive chronic myeloid leukemia.
20520635 data indicate the presence of an 'in trans' deregulated transcription of both BCR and BCR-ABL promoters, associated with CML progression
20463552 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20452982 elevated Src family kinase activity is sufficient to induce imatinib resistance through a mechanism that may involve phosphorylation of Bcr-Abl
20442314 The functional interaction between Bcr-Abl and mitosis dysfunctions, due to compromised mitotic checkpoints, may have important implications for the generation of aneuploidy and CML progression.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20351714 Observational study of gene-disease association. (HuGE Navigator)
20207846 Small interfering RNA against BCR-ABL transcripts sensitize mutated T315I cells to nilotinib.
20141430 Increased expression of bcr-abl is associated with chronic myeloid leukemia.
20038234 Studiies indicate that KD mutations conferring high-level imatinib resistance are present in patients with de novo CML and in some of them lead to disease progression.
20028985 Bcr-Abl represses the expression of RKIP, continuously activates pERK1/2, and suppresses FoxM1 expression, resulting in proliferation of CML cells.
20015884 Point mutations in the BCR-ABL kinase domain is associated with imatinib resistance in Philadelphia chromosome-positive chronic myeloid leukemia.
20010464 Twelve mutations were detected in 11 of 92 chronic myeloid leukemia patients, including 4 mutations (36.7%) diagnosed during CP, 3 (27.3%) in acceleration
20007699 Study suggests important roles of BCR-ABL gene expression and its native chromosomal locus for acquisition of BCR-ABL mutations and provides a new tool for further studying resistance mechanisms.
19911011 Observational study of gene-disease association. (HuGE Navigator)
19876398 reciprocal ABL/BCR fusion proteins as second oncogenes encoded by the t(9;22) in addition to BCR/ABL
19840940 TG2 regulates levels of cellular GTP-bound Rac and actin cytoskeletal reorganization through a new mechanism involving direct inhibition of Bcr GTPase-activating activity.
19724931 Report DNA vaccination against bcr-abl-positive cells in mice.
19718053 Activation of Cdc42 GTPase through p210(Bcr-Abl) tyrosine kinase signaling in CML cells contributes to defects in SDF-1alpha-chemotactic response due to desensitization of the actin polarization signal required for directional migration.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19652056 Impact of baseline BCR-ABL mutations on response to nilotinib in patients with chronic myeloid leukemia in chronic phase.
19625707 BCR-abl transcript rise cutoffs of 5-fold or greater had poor diagnostic sensitivity and no significant association with mutations.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19619277 P-gp and BCRP are inhibited by a novel chalcone derivative, JAI-51
19608682 Data show that the the BCR-ABL fusion protein is captured and detected by a cytometric bead assay and analyzed by flow cytometry.
19571320 BCR-ABL promotes the frequency of mutagenic single-strand annealing DNA repair
19557636 analysis of exon 6 bcr-abl mutations in patients with chronic myeloid leukemia treated with tyrosine kinase inhibitors
19557636 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19369965 The 'gatekeeper mutation' T315I confers additional leukemogenic activity to BCR/ABL, which might explain the clinical behavior of patients with BCR/ABL-T315I-positive blasts
19295548 Bcr-Abl expression increases Nox-4-generated ROS, which in turn increases survival signaling through PI3k/Akt pathway by inhibition of PP1alpha, thus contributing to the high level of resistance to apoptosis seen in TonB.210 cells.
19261608 Bcr-Abl represses the expression of PHLPP1 and PHLPP2 and continuously activates Akt1, -2, and -3 via phosphorylation on Ser-473, resulting in the proliferation of CML cells
19240172 Mutation in the kinase domain of Bcr-Abl is associated with resistance to STI571.
19203346 the loss of Bcr-Abl in imatinib-resistant K562 cells led to the down-regulation of c-FLIP and subsequent increase of TRAIL sensitivity
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19135771 early cellular and transcriptional effects of P190 BCR/ABL1 and P210 BCR/ABL1 expression are very similar when expressed in the same human progenitor cell population, and STAT5 is an important regulator of BCR/ABL1-induced erythroid cell expansion
19067742 findings demonstrate that in children like in adults specific BCR/ABL transcript types present at diagnosis are associated with distinct haematological alterations
19061839 BCR-ABL inhibition is sufficient to commit chronic myeloid leukemia cells irreversibly to apoptosis
19048492 detection of Bcr/Abl transcripts in newly diagnosed chronic myelogenous leukemia cases
19020542 BCR/ABL enhances the accumulation of DSBs and alters the apoptotic threshold in CML leading to error-prone DNA repair
18976975 Knockdown of breakpoint cluster region (BCR) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18827185 BCR-ABL1 plays causal role in pathogenesis of chronic myeloid leukemia exhibiting deregulated cell proliferation, growth factor independence and reduced apoptosis resulting from signal pathways activation
18809762 compared BCR-ABL transcript type and level with kinase domain (KD) mutation status, genotype, and phenotype in 1855 Ph(+) leukemias
18794796 Hck has a nonredundant function as a key downstream signaling partner for Bcr-Abl and may represent a potential drug target in CML
18784740 a thorough biochemical comparative analysis of NUP214-ABL1 and BCR-ABL1 show that, despite their common tyrosine kinase domain, the two fusion proteins differ in many critical catalytic properties
18704194 BCR-ABL leukemogenesis inis blocked by PI3K in mice, and a dual PI3K/mTOR inhibitor prevents expansion of human BCR-ABL+ leukemia cells
18676680 Observational study of gene-disease association. (HuGE Navigator)
18617057 BCR/ABL fusion was the least frequent (2.7%)in this mexican population.
18603549 Novel point mutations should be confirmed by analyzing the normal ABL alleles to exclude polymorphisms
18603297 BCR-ABL gene mutations in Philadelphia chromosome positive leukemia patients is associated with resistance to STI-571 cancer therapy
18549649 No relationship can be confirmed between SNPs in bcr gene and chronic myelogenous leukemia.
18549649 Observational study of gene-disease association. (HuGE Navigator)
18538733 Expression of miR-203 reduces ABL1 and BCR-ABL1 fusion protein levels and inhibits tumor cell proliferation in an ABL1-dependent manner, suggesting it may function as a tumor suppressor.
18503828 BCR-JAK2 fusion gene has the same breakpoint in BCR as is found in the BCR/ABL p210. The chimeric gene is the result of a reciprocal translocation between chromosomes 9 and 22, which implies a double break on chromosome 9
18495245 co-expression of the p210 and p190 transcripts during progression to the blastic phase
18474292 BCR can be considered as a candidate tumor suppressor gene localized on chromosome 22q which may be involved in meningioma pathogenesis.
18406872 Deletions adjacent to BCR and ABL1 breakpoints occur in a substantial minority of chronic myeloid leukemia patients with masked Philadelphia rearrangements
18406870 BCR deletions are not associated with the complexity of translocation genesis of chronic myeloid leukemia
18385754 Mutation of Bcr-Abl in chronic myelogenous leukemia is associated with resistance to Gleevec and sensitive to beta-phenylethyl isothiocyanate
18354488 BCR-ABL deletion mutants lacking kinase domain is associated with decreased drug sensitivity in patients with chronic myeloid leukemia
18287094 BCR-ABL impairs host defenses and promotes malignant transformation, involving dual suppression of IFN-activated signaling pathways
18246120 Bcr-Abl oncogene is responsible for the initial phase of chronic myelogenous leukemia, which is effectively treated by the Bcr-Abl inhibitor imatinib.
18227349 mice injected with p210(BCR/ABL)-transduced p53(-/-)c-Myb(w/w) marrow cells developed leukemia rapidly
18082628 These results demonstrate that allele-specific changes in gene expression, with selective, progressive silencing of the wild-type ABL1 allele in favor of the oncogenic BCR-ABL1 allele occur in CML patients with therapy-resistant disease.
18070886 Bcr GTPase-activating domain activity is regulated through direct protein/protein interaction with the Rho guanine nucleotide dissociation inhibitor
17939855 CML staining in cortical neurons and cerebral vessels is related to the severity of cognitive impairment in people with cerebrovascular disease and only minimal Alzheimer pathology.
17934518 The inhibitory function of Bcr directed toward Bcr-Abl requires its kinase function.
17822820 found that the allele frequency of Ser796 was significantly higher in non-responders than in responders in lithium treatment of bipolar disease.
17822820 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17768128 A novel e8/a4 BCR/ABL fusion transcript is associated with a transformed Sezary syndrome
17762503 The incidence of BCR-ABL fusion oncogene in Pakistani patients with childhood acute lymphoid leukemia is diferent from other populations.
17710227 suggest a role for a combination of ABL kinase inhibitors, perhaps including VX-680, to prevent the outgrowth of cells harboring drug-resistant BCR-ABL mutations
17638918 BCR/ABL-Y177 plays an essential role in Ras and Akt activation and in human hematopoietic progenitor transformation in chronic myelogenous leukemia
17638851 Strategies targeting signals in the marrow microenvironment that amplify the Bcr-abl/VE-cadherin/beta-catenin axis may have utility in sensitizing drug-resistant leukemic stem cells.
17597804 p210BCR-ABL oncoprotein activity is linked to centrosomal hypertrophy
17579186 T-cell repertoire of a patient with chronic myeloid leukemia in major molecular remission due to imatinib mesylate was also dominated by T cells directed against Bcr-Abl-regulated antigens
17374743 Ubp43 deficiency increases the resistance to oncogenic transformation by BCR-ABL
17349636 The expression of Bcr-Abl leads to hyper-responsiveness of myeloid cells to TGFbeta; this novel cross-regulatory mechanism might play an important role in maintaining the transformed progenitor cell population in CML.
17347407 Bcr-Abl overexpression results in increased proliferation and antiapoptotic signaling in CD34(+) cells, but may not play a direct role in imatinib resistance in progenitor cells expressing either wild-type or mutant BCR/ABL genes.
17303698 BCR-ABL mutations confer resistance to the Abl kinase inhibitor AMN107 (nilotinib) in chronic myeloid leukemia
17196995 a system akin to the BCR-ABL translocation of CML may be involved in genomic instability in about one-third of colorectal carcinomas
17145570 The frequency in each type of BCR-ABL transcript in Korean chronic myeloid leukemia patients is different from those of Western countries.
17102890 Mutations on the Abelson tyrosine kinase domain of the bcr-abl gene translocation confers drug resistance to the kinase blocking agent SIT571
17090304 data presented here describe for the first time an analysis of the biological function of the reciprocal t(9;22) ABL/BCR fusion proteins in comparison to their physiological counterpart BCR
17018862 Bach2 is phosphorylated on S521 via Bcr-Abl signaling thru the phosphatidylinositol-3/S6 kinase pathway,and transcriptionally represses heme oxygenase-1
16998483 BCR-ABL-expressing leukemic stem cells depend to a greater extent on CD44 for homing and engraftment than do normal hematopoietic stem cells
16966279 retention of a dephosphorylated p210Bcr-Abl has a biologic impact distinct from that of downregulation/loss of p210Bcr-Abl and, in a subset of patients, loss of the target of the kinase inhibitor may lead to imatinib mesylate resistance
16955467 By lysing primary hemopoietic cells at high pH, BCR-ABL1 protein-degradative activity was inhibited & association between BCR-ABL1 protein in complexes with adaptor proteins CBL, CRKL & GRB2 in primary chronic myeloid leukaemia material was demonstrated
16914906 Impact of novel oral BCR-ABL tyrosine kinase inhibitors on the outcome of Thai chronic myeloid leukemia patients with different BCR-ABL gene variants.
16912036 the Bcr-Abl SH3-SH2 region is phosphorylated by Src family kinases, which modulate Bcr-Abl transforming activity
16888785 The molecular breakpoint of the BCR-ABL fusion gene has been characterized for 122 chronic myeloid leukemia patients.
16855631 Sixty-six mutations in 23 amino acids were identified in 62 (36%) patients not responding to imatinib in chronic myeloid leukemia
16849647 Synthesis of histamine was found to be restricted to the basophil compartment of the CML clone and to depend on signaling through the PI3-kinase pathway. CML cells also expressed histamine receptors
16670264 BCR-ABL can regulate protein levels by governing secretion, a novel mechanism for this tyrosine kinase in acute myeloid leukemia.
16631477 A novel and complex Ph chromosome-negative Chronic myeloid leukemia (CML) case with a t(6;9)(p21;q34.1) in which the BCR/ABL fusion gene is located at 6p21.
16598834 The ABL gene was inserted into the BCR region of chromosome 22 in chronic myelogenous leukemia.
16596225 Molecular monitoring of the BCR-ABL transcript in chronic myelogenous leukemia (CML) using quantitative RT-PCR provides diagnostic and prognostic information, but levels differ in blood and bone marrow samples.
16543472 BCRP causes measurable imatinib resistance, but this effect is attenuated by imatinib-mediated inhibition of BCR-ABL, which in turn downregulates overall BCRP levels posttranscriptionally via the PI3K-Akt pathway.
16502580 Detection BCR-ABL fusion signal in both metaphase spreads and interphase cells of patients with chronic myeloid leukemia.
16502579 Mutations have been detected over a range of 242 amino acids, which span the entire kinase region and may account for resistance to imatinib mesylate.
16494625 The rate of glycolysis is significantly increased in Bcr-Abl expressing cells in a PI3K-dependent manner.
16490599 The minor BCR-ABL fusion gene involving a secondary Philadelphia chromosome superimposed on inversion(3) and monosomy 7 has not previously been reported in acute myelocytic leukemia.
16481037 Adaphostin+/-bortezomib circumvent imatinib resistance due to Bcr/Abl point mutations most likely through reactive oxygen species generation.
16469868 The ability to negate calcium-dependent apoptotic signaling is a major prosurvival mechanism in Bcr-Abl-expressing cells.
16449534 Pattern of BCR-ABL transcript levels after allograft is variable after stem cell transplantation for chronic myeloid leukemia.
16442619 Enriched CD34+ cells from patients with BCR-ABL-positve chronic myelocytic leukemia in chronic phase or blast crisis do not associate blast crisis with mutation.
16442529 Expressed Bcr is able to bind the transcription factor Tcf1 to disrupt the Tcf1/beta-catenin complex. Phosphorylation of Bcr by the tyrosine kinase pp60(src) can lead to dissociation of the transcriptionally inactive Bcr/Tcf1 complex
16418324 Identification of the CEBPB gene as a target of translational regulation in myeloid precursor cells transformed by the BCR/ABL oncogene.
16264277 detected the new mutation of BCR/ABL, resulting in premature termination and loss of BCR/ABL fusion protein expression
16116902 Achievement of molecular remission in BCR-ABL-positive ALL occurs also in standard chemotherapy but molecular remissions begin 2-4 months later than clinicohematological ones.
16079118 Sequence deletoin detected in chronic myeloid leukemia.
15968309 Observational study of genetic testing. (HuGE Navigator)
15866548 Observational study of gene-disease association. (HuGE Navigator)
15857938 ability of Bcr-Abl to stimulate the expression of osteopontin
15735728 Bcr-Abl-induced abnormalities in glucose transport regulation have roles in chronic myeloid leukaemia
15723338 Along with ABL, deleted in leukemia, myeloid, philadelphia-positive.
15716990 the incidence of deletions from the der(9) in childhood acute lymphoblastic leukemia is at least as high as that reported for chronic myeloid leukemia.
15684424 Results report the solution structure of AF-6 PDZ domain and its interaction with the C-terminal peptides from Neurexin and Bcr.
15626746 MCL-1 is a BCR/ABL-dependent survival factor and interesting target in chronic myeloid leukemia.
15542838 Bcr-Abl mediates protection from apoptosis downstream of mitochondrial cytochrome c release
15494376 We have examined the ability of Bcr to interact with other epithelial PDZ proteins and found specific binding to both the apical PDZK1 protein and the Golgi-localized Mint3.
15481444 FISH analysis of the abl and bcr genes showed the signal for bcr/abl fusion on the der(22) chromosome but not on the der(9) chromosome in Philadelpha-Negative chronic myeloid leukemia.
15248918 Observational study of gene-disease association. (HuGE Navigator)
15145216 identified 61 genes up-regulated by BCR/ABL1, including genes encoding transcription factors, kinases, and signal transduction molecules, as well as genes regulating cell growth, differentiation, apoptosis, and cell adhesion
14993251 BCR-ABL1 kinase activity is linked to defective pre-B cell receptor signaling
14966468 bcr-abl transcript can be detected in the PBLs of Philadelphia chromosome (Ph)-negative essential thrombocythemia but the level of expression is markedly less than that in CML
14961028 identified a BCR/ABL-dependent increase in expression of multiple genes involved in pre-mRNA splicing; generic changes in pre-mRNA splicing as a result of p210BCR/ABL kinase activity may contribute to CML pathogenesis
14656881 ICSBP antagonizes BCR/ABL by down-regulation of bcl-2, implicating a central role for ICSBP in the pathogenesis of chronic myelogenous leukemia
14654084 Endoplasmic reticulum stress resulting from inhibition of p210 bcr-abl triggers apoptosis in CML; leading to Bcl-2 dowmodulation and inactivation, release of caspase 12 from the ER membranes in its active form, and Ca(2+)release from the ER pool
14581377 down-regulation of Bcr-Abl mRNA might be one of the mechanisms implicated in the apicidin-mediated apoptosis in the K562 cells
14534537 BCR fuses with ABL to form a fusion protein.
12890867 Expression of BCR/ABL and BCL-2 in myeloid progenitors leads to myeloid leukemias.
12821944 BCR-ABL has a role in differentiation of embryonic stem cells
12808105 Bcr kinase downregulates Ras signaling by phosphorylating AF-6 and binding to its PDZ domain
12781448 BCR/ABL amplification may play a role as a novel mechanism in the progression to an aggressive blast transformation in some cases of Philadelphia chromosome-positive chronic myelocytic leukemia
12764153 BCR-ABL is inhibited by lyp tyrosine phosphatase
12734675 analyzed the clinical significance of bcr/abl mRNA levels in patients with chronic myeloid leukemia undergoing prolonged treatment with imatinib mesylate
12560071 concluded that the IRS-1 protein is involved in the signalling pathway of the BCR-ABL tyrosine kinase
12556557 constitutively activated Bcr-Abl kinase pathways in primitive CML progenitors cooperate with growth factors producing a growth response and disrupt the normally required synergistic interactions between kit ligand and other cytokines to achieve activation
12408765 expression of bcr/abl hybridized gene in chronic myeloid leukemia (CML), acute lymphatic leukemia (ALL) and polycythemia vera (PV), and its clinical significance
12145699 2 cases of e19a2-positive CML with a new in-frame BCR exon e16 deletion are reported.
12096337 p38 MAPK-mediated activation of NF-kappaB by the RhoGEF domain of Bcr
11746971 In the fusion of the BCR and FGFR1 genes in myeloproliferative disorder, it is likely that the dimerization properties of BCR lead to aberrant FGFR1 signaling and neoplastic transformation.

AA Sequence

MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSY      1 - 70
DRQRWGFRRAAQAPDGASEPRASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASG     71 - 140
ERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNVEFHHERGLVKVNDKEVSDRISSLGSQAMQM    141 - 210
ERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQ    211 - 280
SIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQS    281 - 350
SRVSPSPTTYRMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEG    351 - 420
AFHGDADGSFGTPPGYGCAADRAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASEL    421 - 490
DLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEF    491 - 560
YDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA    561 - 630
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMT    631 - 700
VKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDEL    701 - 770
EAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRN    771 - 840
GKSYTFLISSDYERAEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLY    841 - 910
GFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNEEFEIELEGSQTLRILCYEKC    911 - 980
YNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTG    981 - 1050
VFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMD   1051 - 1120
VNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVA   1121 - 1190
EKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDS   1191 - 1260
KRQSILFSTEV                                                              1261 - 1271
//

Text Mined References (347)

PMID Year Title
27273956 Correlation of p210 BCR-ABL transcript variants with clinical, parameters and disease outcome in 45 chronic myeloid leukemia patients.
26831735 2016 Secretion of IL-1? from imatinib-resistant chronic myeloid leukemia cells contributes to BCR-ABL mutation-independent imatinib resistance.
26721204 2016 Blockade of the interaction between Bcr-Abl and PTB1B by small molecule SBF-1 to overcome imatinib-resistance of chronic myeloid leukemia cells.
26607903 2016 Perturbation of energy metabolism by fatty-acid derivative AIC-47 and imatinib in BCR-ABL-harboring leukemic cells.
26429162 2015 Real-time quantitative PCR detection of WT1 and M-BCR-ABL expressions in chronic myeloid leukemia.
26295305 2015 Non genomic loss of function of tumor suppressors in CML: BCR-ABL promotes I?B? mediated p53 nuclear exclusion.
26291129 2015 MAPK15 mediates BCR-ABL1-induced autophagy and regulates oncogene-dependent cell proliferation and tumor formation.
26264145 2015 Prevalence of common fusion transcripts in acute lymphoblastic leukemia: A report of 304 cases.
26252834 2015 Molecular characterization and follow-up of five CML patients with new BCR-ABL1 fusion transcripts.
26186983 Cytogenetic, fluorescence in situ hybridization, and genomic array characterization of chronic myeloid leukemia with cryptic BCR-ABL1 fusions.
26179066 2015 BCR/ABL1 and BCR are under the transcriptional control of the MYC oncogene.
26087013 2015 Clonal Evolution and Blast Crisis Correlate with Enhanced Proteolytic Activity of Separase in BCR-ABL b3a2 Fusion Type CML under Imatinib Therapy.
25876659 2015 Dominant negative form of alpha4 inhibits the BCR crosslinking-induced phosphorylation of Bcl-xL and apoptosis in an immature B cell line WEHI-231.
25769542 2015 Expression profiling of adult acute lymphoblastic leukemia identifies a BCR-ABL1-like subgroup characterized by high non-response and relapse rates.
25756742 2015 Switching to second-generation tyrosine kinase inhibitor improves the response and outcome of frontline imatinib-treated patients with chronic myeloid leukemia with more than 10% of BCR-ABL/ABL ratio at 3 months.
25740611 2015 Incidence and clinical importance of BCR-ABL1 mutations in Iranian patients with chronic myeloid leukemia on imatinib.
25730044 2015 Quantitative real-time polymerase chain reaction as an efficient molecular tool for detecting minimal residual disease in Moroccan chronic myeloid leukemia patients.
25721898 2015 A coiled-coil mimetic intercepts BCR-ABL1 dimerization in native and kinase-mutant chronic myeloid leukemia.
25648025 2014 Status of leptin in MBCR-ABL p210 positive chronic myeloid leukemia patients before and after imatinib therapy: a conflicting scenario.
25644089 2015 Anti-cancer fatty-acid derivative induces autophagic cell death through modulation of PKM isoform expression profile mediated by bcr-abl in chronic myeloid leukemia.
25631082 2015 Kaposi's sarcoma-associated herpesvirus microRNAs repress breakpoint cluster region protein expression, enhance Rac1 activity, and increase in vitro angiogenesis.
25615000 2015 Emergence of BCR-ABL kinase domain mutations associated with newly diagnosed chronic myeloid leukemia: a meta-analysis of clinical trials of tyrosine kinase inhibitors.
25520136 2014 Clinical significance of BCR-ABL fusion gene subtypes in chronic myelogenous and acute lymphoblastic leukemias.
25479544 2014 The EGFR pathway regulates BCRP expression in NSCLC cells: role of erlotinib.
25379619 2015 Patients with Philadelphia-positive leukemia with Y253H or F359V mutation have a high risk of developing new mutations in the setting of dasatinib resistance.
25331951 2014 Src homology 2 domain containing protein 5 (SH2D5) binds the breakpoint cluster region protein, BCR, and regulates levels of Rac1-GTP.
25293778 2014 BCR-ABL1 promotes leukemia by converting p27 into a cytoplasmic oncoprotein.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25217883 2015 Inhibition of 32Dp210 cells harboring T315I mutation by a novel derivative of emodin correlates with down-regulation of BCR-ABL and its downstream signaling pathways.
25213664 2014 The malignancy suppression role of miR-23a by targeting the BCR/ABL oncogene in chromic myeloid leukemia.
25134459 2015 Combined STAT3 and BCR-ABL1 inhibition induces synthetic lethality in therapy-resistant chronic myeloid leukemia.
25132497 2014 BCR-ABL1 compound mutations combining key kinase domain positions confer clinical resistance to ponatinib in Ph chromosome-positive leukemia.
24998540 2014 BCR/ABL mRNA targeting small interfering RNA effects on proliferation and apoptosis in chronic myeloid leukemia.
24967705 2014 ATRA-induced cellular differentiation and CD38 expression inhibits acquisition of BCR-ABL mutations for CML acquired resistance.
24903628 2014 Cell sorting enables interphase fluorescence in situ hybridization detection of low BCR-ABL1 producing stem cells in chronic myeloid leukaemia patients beyond deep molecular remission.
24856998 2014 [Clinical characteristics of childhood leukemia with EVI1 gene and BCR/ABL gene co-expression].
24836440 2014 BCR-ABL affects STAT5A and STAT5B differentially.
24779036 2014 Involvement of primary mesenchymal precursors and hematopoietic bone marrow cells from chronic myeloid leukemia patients by BCR-ABL1 fusion gene.
24675360 2014 BCR-ABL-induced deregulation of the IL-33/ST2 pathway in CD34+ progenitors from chronic myeloid leukemia patients.
24550512 2014 Molecular dynamics reveal BCR-ABL1 polymutants as a unique mechanism of resistance to PAN-BCR-ABL1 kinase inhibitor therapy.
24487968 2014 Curcumin derivative C817 inhibits proliferation of imatinib-resistant chronic myeloid leukemia cells with wild-type or mutant Bcr-Abl in vitro.
24456693 2014 BCR-ABL kinase domain mutations, including 2 novel mutations in imatinib resistant Malaysian chronic myeloid leukemia patients-Frequency and clinical outcome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269846 2014 Single-cell analysis of K562 cells: an imatinib-resistant subpopulation is adherent and has upregulated expression of BCR-ABL mRNA and protein.
24262285 2014 Molecular analysis of the BCR-ABL1 kinase domain in chronic-phase chronic myelogenous leukemia treated with tyrosine kinase inhibitors in practice: study by the Nagasaki CML Study Group.
23980151 2013 Dissection of the BCR-ABL signaling network using highly specific monobody inhibitors to the SHP2 SH2 domains.
23974192 2013 Independent prognostic value of BCR-ABL1-like signature and IKZF1 deletion, but not high CRLF2 expression, in children with B-cell precursor ALL.
23940119 2013 The GEF Bcr activates RhoA/MAL signaling to promote keratinocyte differentiation via desmoglein-1.
23934627 2014 Bcr-Abl activates AURKA and AURKB in chronic myeloid leukemia cells via AKT signaling.
23894305 2013 Low expression of miR-196b enhances the expression of BCR-ABL1 and HOXA9 oncogenes in chronic myeloid leukemogenesis.
23799845 2013 BCR-ABL1 kinase domain mutations may persist at very low levels for many years and lead to subsequent TKI resistance.
23788109 2013 Additive antileukemia effects by GFI1B- and BCR-ABL-specific siRNA in advanced phase chronic myeloid leukemic cells.
23716543 2013 The BCR-ABLT315I mutation compromises survival in chronic phase chronic myelogenous leukemia patients resistant to tyrosine kinase inhibitors, in a matched pair analysis.
23604228 2013 Anti-oxidant vitamin E prevents accumulation of imatinib-resistant BCR-ABL1 kinase mutations in CML-CP xenografts in NSG mice.
23588714 2013 Distribution of genomic breakpoints in chronic myeloid leukemia: analysis of 308 patients.
23547655 2013 Rapid initial decline in BCR-ABL1 is associated with superior responses to second-line nilotinib in patients with chronic-phase chronic myeloid leukemia.
23458731 2012 STAT5 triggers BCR-ABL1 mutation by mediating ROS production in chronic myeloid leukaemia.
23428668 2013 miR-29b suppresses CML cell proliferation and induces apoptosis via regulation of BCR/ABL1 protein.
23396943 2013 Tolerant anti-insulin B cells are effective APCs.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23317202 2012 Five most common prognostically important fusion oncogenes are detected in the majority of Pakistani pediatric acute lymphoblastic leukemia patients and are strongly associated with disease biology and treatment outcome.
23289360 2013 The BCR-ABL1 T315I mutation and additional genomic aberrations are dominant genetic lesions associated with disease progression in patients with chronic myelogenous leukemia resistant to tyrosine kinase inhibitor therapy.
23287430 2013 Decreased microRNA-30a levels are associated with enhanced ABL1 and BCR-ABL1 expression in chronic myeloid leukemia.
23277196 2013 Mechanisms of resistance to BCR-ABL and other kinase inhibitors.
23269583 2013 Analysis of the clinico-hematological relevance of the breakpoint location within M-BCR in chronic myeloid leukemia.
23223358 2013 BCR-ABL1 compound mutations in tyrosine kinase inhibitor-resistant CML: frequency and clonal relationships.
23207522 2013 Contributions of the RhoGEF activity of p210 BCR/ABL to disease progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23171834 2013 A case of 8p11 myeloproliferative syndrome with BCR-FGFR1 gene fusion presenting with trilineage acute leukemia/lymphoma, successfully treated by cord blood transplantation.
23124138 2013 The tyrosine phosphatase TC48 interacts with and inactivates the oncogenic fusion protein BCR-Abl but not cellular Abl.
23086624 2012 Characteristics and outcomes of patients with V299L BCR-ABL kinase domain mutation after therapy with tyrosine kinase inhibitors.
23065514 2013 The quantitative level of T315I mutated BCR-ABL predicts for major molecular response to second-line nilotinib or dasatinib treatment in patients with chronic myeloid leukemia.
23062378 2013 Emerging kinetics of BCR-ABL1 mutations and their effect on disease outcomes in chronic myeloid leukemia patients with imatinib failure.
23062104 2013 Concomitant detection of BCR-ABL translocation and JAK2 V617F mutation in five patients with myeloproliferative neoplasm at diagnosis.
23047475 2013 BCR-ABL1 kinase inhibits uracil DNA glycosylase UNG2 to enhance oxidative DNA damage and stimulate genomic instability.
22957062 2012 Knocking down low molecular weight protein tyrosine phosphatase (LMW-PTP) reverts chemoresistance through inactivation of Src and Bcr-Abl proteins.
22896000 2012 Phase 2 study of subcutaneous omacetaxine mepesuccinate after TKI failure in patients with chronic-phase CML with T315I mutation.
22847163 2012 Concomitant BCR-ABL1 translocation and JAK2(V617F) mutation in three patients with myeloproliferative neoplasms.
22787435 2012 A requirement for SOCS-1 and SOCS-3 phosphorylation in Bcr-Abl-induced tumorigenesis.
22782217 2013 TAT-CC fusion protein depresses the oncogenicity of BCR-ABL in vitro and in vivo through interrupting its oligomerization.
22772060 2013 MK-0457, an Aurora kinase and BCR-ABL inhibitor, is active in patients with BCR-ABL T315I leukemia.
22665066 2013 BCR-ABL regulates death receptor expression for TNF-related apoptosis-inducing ligand (TRAIL) in Philadelphia chromosome-positive leukemia.
22593461 2012 T315I mutation in Ph-positive acute lymphoblastic leukemia is associated with a highly aggressive disease phenotype: three case reports.
22591684 2012 Src, Akt, NF-?B, BCL-2 and c-IAP1 may be involved in an anti-apoptotic effect in patients with BCR-ABL positive and BCR-ABL negative acute lymphoblastic leukemia.
22587422 2012 Pharmacokinetics of dasatinib for Philadelphia-positive acute lymphocytic leukemia with acquired T315I mutation.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
22526369 2012 Comparative study of BCR-ABL1 quantification: Xpert assay, a feasible solution to standardization concerns.
22471662 2012 Therapeutic targeting of BCR-ABL: prognostic markers of response and resistance mechanism in chronic myeloid leukaemia.
22447844 2012 Cyclin-dependent kinase 7/9 inhibitor SNS-032 abrogates FIP1-like-1 platelet-derived growth factor receptor ? and bcr-abl oncogene addiction in malignant hematologic cells.
22384256 2012 Transforming and tumorigenic activity of JAK2 by fusion to BCR: molecular mechanisms of action of a novel BCR-JAK2 tyrosine-kinase.
22327125 2012 Properties of bcr-abl-transformed mouse 12B1 cells secreting interleukin-2 and granulocyte-macrophage colony-stimulating factor: I. Derivation, genetic stability, oncogenicity and immunogenicity.
22233112 2012 BCR-ABL activity measured by 50% inhibitory concentration for imatinib, p-CrkL/CrkL ratio or p-CrkL ratio in CD34+ cells of patients with chronic myeloid leukemia does not predict treatment response.
22231445 2012 STAP-2 interacts with and modulates BCR-ABL-mediated tumorigenesis.
22230800 2012 Prevalence and dynamics of bcr-abl kinase domain mutations during imatinib treatment differ in patients with newly diagnosed and recurrent bcr-abl positive acute lymphoblastic leukemia.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22184410 2012 Chronic myeloid leukemia stem cells are not dependent on Bcr-Abl kinase activity for their survival.
22153077 2011 Structural basis and sequence rules for substrate recognition by Tankyrase explain the basis for cherubism disease.
21960589 2011 Developmental origins and impact of BCR-ABL1 fusion and IKZF1 deletions in monozygotic twins with Ph+ acute lymphoblastic leukemia.
21935931 2011 Bcr-Abl oncogene stimulates Jab1 expression via cooperative interaction of ?-catenin and STAT1 in chronic myeloid leukemia cells.
21908428 2011 FcRL4 acts as an adaptive to innate molecular switch dampening BCR signaling and enhancing TLR signaling.
21903771 2011 BCR-ABL transcript dynamics support the hypothesis that leukemic stem cells are reduced during imatinib treatment.
21900237 2011 CDK1-mediated phosphorylation of Abi1 attenuates Bcr-Abl-induced F-actin assembly and tyrosine phosphorylation of WAVE complex during mitosis.
21895409 2011 Use of direct sequencing for detection of mutations in the BCR-ABL kinase domain in Slovak patients with chronic myeloid leukemia.
21764785 2011 In vivo imaging of Bcr-Abl overexpressing tumors with a radiolabeled imatinib analog as an imaging surrogate for imatinib.
21762985 2011 Low-level Bcr-Abl mutations are very rare in chronic myeloid leukemia patients who are in major molecular response on first-line nilotinib.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
21693761 2011 Agammaglobulinemia associated with BCR? B cells and enhanced expression of CD19.
21674858 Frequency of BCR-ABL fusion transcripts in Serbian patients with chronic myeloid leukemia.
21641753 2011 Purification of TAT-CC-HA protein under native condition, and its transduction analysis and biological effects on BCR-ABL positive cells.
21504383 2011 Does pretreatment fluorescence in situ hybridization for BCR-ABL predict imatinib-associated hematologic toxicity in chronic myeloid leukemia?
21489624 2011 F317L BCR-ABL1 kinase domain mutation associated with a sustained major molecular response in a CML patient on dasatinib.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21330459 2011 Targeting ovarian tumor cell adhesion mediated by tissue transglutaminase.
21310073 2011 Bcr is a substrate for Transglutaminase 2 cross-linking activity.
21269460 2011 Initial characterization of the human central proteome.
21266020 2011 Three novel alternative splicing mutations in BCR-ABL1 detected in CML patients with resistance to kinase inhibitors.
21248063 2011 Bcr-Abl ubiquitination and Usp9x inhibition block kinase signaling and promote CML cell apoptosis.
21239056 2011 BCR-ABL1 mutations in patients with imatinib-resistant Philadelphia chromosome-positive leukemia by use of the PCR-Invader assay.
21203397 2010 Bcr/Abl interferes with the Fanconi anemia/BRCA pathway: implications in the chromosomal instability of chronic myeloid leukemia cells.
21183952 2011 Janus kinase 2 regulates Bcr-Abl signaling in chronic myeloid leukemia.
21156844 2011 Results of allogeneic hematopoietic stem cell transplantation for chronic myelogenous leukemia patients who failed tyrosine kinase inhibitors after developing BCR-ABL1 kinase domain mutations.
21045136 2010 Exon 7 deletion in the bcr-abl gene is frequent in chronic myeloid leukemia patients and is not correlated with resistance against imatinib.
20739956 2010 Analysis of BCR-ABL1 tyrosine kinase domain mutational spectra in primitive chronic myeloid leukemia cells suggests a unique mutator phenotype.
20717963 2011 Bcr-Abl-induced tyrosine phosphorylation of Emi1 to stabilize Skp2 protein via inhibition of ubiquitination in chronic myeloid leukemia cells.
20697350 2010 The proximal signaling network of the BCR-ABL1 oncogene shows a modular organization.
20633771 2010 A unique BCR-ABL1 transcript with the insertion of intronic sequence from BCR and ABL1 genes in a patient with Philadelphia-positive chronic myeloid leukemia: a case study.
20607847 2010 Associations between imatinib resistance conferring mutations and Philadelphia positive clonal cytogenetic evolution in CML.
20520635 2010 BCR and BCR-ABL regulation during myeloid differentiation in healthy donors and in chronic phase/blast crisis CML patients.
20463552 2010 Genome-wide examination of genetic variants associated with response to platinum-based chemotherapy in patients with small-cell lung cancer.
20452982 2010 Expression of a Src family kinase in chronic myelogenous leukemia cells induces resistance to imatinib in a kinase-dependent manner.
20442314 2010 Expression of oncogenic kinase Bcr-Abl impairs mitotic checkpoint and promotes aberrant divisions and resistance to microtubule-targeting agents.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
20207846 2010 Small interfering RNA against BCR-ABL transcripts sensitize mutated T315I cells to nilotinib.
20141430 2010 Co-expression of HoxA9 and bcr-abl genes in chronic myeloid leukemia.
20038234 2010 Kinase domain mutations of BCR-ABL identified at diagnosis before imatinib-based therapy are associated with progression in patients with high Sokal risk chronic phase chronic myeloid leukemia.
20028985 2010 Reduction of Raf kinase inhibitor protein expression by Bcr-Abl contributes to chronic myelogenous leukemia proliferation.
20015884 2010 Impact of additional chromosomal aberrations and BCR-ABL kinase domain mutations on the response to nilotinib in Philadelphia chromosome-positive chronic myeloid leukemia.
20010464 2009 Frequency of BCR-ABL gene mutations in Polish patients with chronic myeloid leukemia treated with imatinib: a final report of the MAPTEST study.
20007699 2010 BCR-ABL gene expression is required for its mutations in a novel KCL-22 cell culture model for acquired resistance of chronic myelogenous leukemia.
19946888 2010 Defining the membrane proteome of NK cells.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19876398 2009 Reciprocal t(9;22) ABL/BCR fusion proteins: leukemogenic potential and effects on B cell commitment.
19840940 2009 Transglutaminase 2 regulates the GTPase-activating activity of Bcr.
19724931 2009 DNA vaccination against bcr-abl-positive cells in mice.
19718053 2009 p210(Bcr-Abl) desensitizes Cdc42 GTPase signaling for SDF-1alpha-directed migration in chronic myeloid leukemia cells.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19652056 2009 Impact of baseline BCR-ABL mutations on response to nilotinib in patients with chronic myeloid leukemia in chronic phase.
19625707 2009 Determining the rise in BCR-ABL RNA that optimally predicts a kinase domain mutation in patients with chronic myeloid leukemia on imatinib.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19619277 2009 A novel chalcone derivative which acts as a microtubule depolymerising agent and an inhibitor of P-gp and BCRP in in-vitro and in-vivo glioblastoma models.
19608682 2009 An accurate and rapid flow cytometric diagnosis of BCR-ABL positive acute lymphoblastic leukemia.
19571320 2009 BCR-ABL promotes the frequency of mutagenic single-strand annealing DNA repair.
19557636 2009 New mutations detected by denaturing high performance liquid chromatography during screening of exon 6 bcr-abl mutations in patients with chronic myeloid leukemia treated with tyrosine kinase inhibitors.
19369965 2009 The gatekeeper mutation T315I confers resistance against small molecules by increasing or restoring the ABL-kinase activity accompanied by aberrant transphosphorylation of endogenous BCR, even in loss-of-function mutants of BCR/ABL.
19295548 2009 Bcr-Abl-mediated redox regulation of the PI3K/AKT pathway.
19261608 2009 Depletion of Pleckstrin homology domain leucine-rich repeat protein phosphatases 1 and 2 by Bcr-Abl promotes chronic myelogenous leukemia cell proliferation through continuous phosphorylation of Akt isoforms.
19240172 2009 Triptolide inhibits Bcr-Abl transcription and induces apoptosis in STI571-resistant chronic myelogenous leukemia cells harboring T315I mutation.
19203346 2009 Sensitization of imatinib-resistant CML cells to TRAIL-induced apoptosis is mediated through down-regulation of Bcr-Abl as well as c-FLIP.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19135771 2009 Expression of P190 and P210 BCR/ABL1 in normal human CD34(+) cells induces similar gene expression profiles and results in a STAT5-dependent expansion of the erythroid lineage.
19067742 2009 Correlation of BCR/ABL transcript variants with patients' characteristics in childhood chronic myeloid leukaemia.
19061839 2008 Transient potent BCR-ABL inhibition is sufficient to commit chronic myeloid leukemia cells irreversibly to apoptosis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19048492 2008 Analysis and comparison of clinicohematological parameters and molecular and cytogenetic response of two Bcr/Abl fusion transcripts.
19020542 2009 BCR/ABL induces chromosomal instability after genotoxic stress and alters the cell death threshold.
18827185 2009 Molecular biology of bcr-abl1-positive chronic myeloid leukemia.
18809762 2008 BCR-ABL fusion transcript types and levels and their interaction with secondary genetic changes in determining the phenotype of Philadelphia chromosome-positive leukemias.
18794796 2008 An inhibitor-resistant mutant of Hck protects CML cells against the antiproliferative and apoptotic effects of the broad-spectrum Src family kinase inhibitor A-419259.
18784740 2008 Intrinsic differences between the catalytic properties of the oncogenic NUP214-ABL1 and BCR-ABL1 fusion protein kinases.
18704194 2008 Ablation of PI3K blocks BCR-ABL leukemogenesis in mice, and a dual PI3K/mTOR inhibitor prevents expansion of human BCR-ABL+ leukemia cells.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18617057 2008 Analysis of gene rearrangements using a fluorescence in situ hybridization method in Mexican patients with acute lymphoblastic leukemia: experience at a single institution.
18603549 2008 ABL single nucleotide polymorphisms may masquerade as BCR-ABL mutations associated with resistance to tyrosine kinase inhibitors in patients with chronic myeloid leukemia.
18603297 2008 Detection of BCR-ABL gene mutations in Philadelphia chromosome positive leukemia patients resistant to STI-571 cancer therapy.
18549649 2008 [Polymorphisms in the breakpoint cluster region of bcr gene].
18538733 2008 Genetic and epigenetic silencing of microRNA-203 enhances ABL1 and BCR-ABL1 oncogene expression.
18503828 2008 A BCR-JAK2 fusion gene as the result of a t(9;22)(p24;q11) in a patient with acute myeloid leukemia.
18495245 2009 Is p190 bcr-abl rearrangement necessary for acute transformation in some p210 CML of childhood?
18474292 2008 BCR expression is decreased in meningiomas showing loss of heterozygosity of 22q within a new minimal deletion region.
18406872 2008 Deletions adjacent to BCR and ABL1 breakpoints occur in a substantial minority of chronic myeloid leukemia patients with masked Philadelphia rearrangements.
18406870 2008 Mechanisms of genesis of variant translocation in chronic myeloid leukemia are not correlated with ABL1 or BCR deletion status or response to imatinib therapy.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18385754 2008 Effective killing of Gleevec-resistant CML cells with T315I mutation by a natural compound PEITC through redox-mediated mechanism.
18354488 2008 Characterization of BCR-ABL deletion mutants from patients with chronic myeloid leukemia.
18287094 2008 Suppression of interferon (IFN)-inducible genes and IFN-mediated functional responses in BCR-ABL-expressing cells.
18246120 2008 Bcr-Abl induces autocrine IGF-1 signaling.
18227349 2008 Requirement of c-Myb for p210(BCR/ABL)-dependent transformation of hematopoietic progenitors and leukemogenesis.
18088087 2008 Phosphoproteome of resting human platelets.
18082628 2008 Expression of BCR-ABL1 oncogene relative to ABL1 gene changes overtime in chronic myeloid leukemia.
18070886 2008 Activity of the Bcr GTPase-activating domain is regulated through direct protein/protein interaction with the Rho guanine nucleotide dissociation inhibitor.
17939855 2007 Immunohistochemical study of N-epsilon-carboxymethyl lysine (CML) in human brain: relation to vascular dementia.
17934518 2008 Kinase domain mutants of Bcr enhance Bcr-Abl oncogenic effects.
17928051 2008 A multiplex PCR for improved detection of typical and atypical BCR-ABL fusion transcripts.
17822820 2008 A possible association between missense polymorphism of the breakpoint cluster region gene and lithium prophylaxis in bipolar disorder.
17768128 2007 Identification of a novel e8/a4 BCR/ABL fusion transcript in a case of a transformed Sézary syndrome.
17762503 2007 Frequency of BCR-ABL fusion oncogene in Pakistani childhood acute lymphoid leukemia (ALL) patients reflects ethnic differences in molecular genetics of ALL.
17710227 2007 Sequential ABL kinase inhibitor therapy selects for compound drug-resistant BCR-ABL mutations with altered oncogenic potency.
17638918 2007 BCR-tyrosine 177 plays an essential role in Ras and Akt activation and in human hematopoietic progenitor transformation in chronic myelogenous leukemia.
17638851 2007 Ph+/VE-cadherin+ identifies a stem cell like population of acute lymphoblastic leukemia sustained by bone marrow niche cells.
17597804 2007 Expression of the p210BCR-ABL oncoprotein drives centrosomal hypertrophy and clonal evolution in human U937 cells.
17579186 2007 The immunogenicity of Bcr-Abl expressing dendritic cells is dependent on the Bcr-Abl kinase activity and dominated by Bcr-Abl regulated antigens.
17374743 2007 Ubp43 regulates BCR-ABL leukemogenesis via the type 1 interferon receptor signaling.
17349636 2007 Upregulation of the TGFbeta signalling pathway by Bcr-Abl: implications for haemopoietic cell growth and chronic myeloid leukaemia.
17347407 2007 Role of BCR/ABL gene-expression levels in determining the phenotype and imatinib sensitivity of transformed human hematopoietic cells.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17303698 2007 Identification of BCR-ABL point mutations conferring resistance to the Abl kinase inhibitor AMN107 (nilotinib) by a random mutagenesis study.
17196995 2007 aCGH local copy number aberrations associated with overall copy number genomic instability in colorectal cancer: coordinate involvement of the regions including BCR and ABL.
17145570 2006 Comprehensive analysis of BCR-ABL transcript types in Korean CML patients using a newly developed multiplex RT-PCR.
17102890 2006 Detection and quantification of the abelson tyrosine kinase domains of the BCR-ABL gene translocation in chronic myeloid leukaemia using genomic quantitative real-time polymerase chain reaction.
17090304 2006 BCR and its mutants, the reciprocal t(9;22)-associated ABL/BCR fusion proteins, differentially regulate the cytoskeleton and cell motility.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17018862 2007 Bcr-Abl signaling through the PI-3/S6 kinase pathway inhibits nuclear translocation of the transcription factor Bach2, which represses the antiapoptotic factor heme oxygenase-1.
16998483 2006 Requirement for CD44 in homing and engraftment of BCR-ABL-expressing leukemic stem cells.
16966279 2006 Distinct biological impact of dephosphorylation vs. downregulation of p210Bcr-Abl: implications for imatinib mesylate response and resistance.
16955467 2006 Detection in primary chronic myeloid leukaemia cells of p210BCR-ABL1 in complexes with adaptor proteins CBL, CRKL, and GRB2.
16914906 2006 Natural history of Southeast Asian chronic myeloid leukemia patients with different BCR-ABL gene variants.
16912036 2006 Src family kinases phosphorylate the Bcr-Abl SH3-SH2 region and modulate Bcr-Abl transforming activity.
16888785 2006 Molecular profiling of chronic myeloid leukemia in eastern India.
16855631 2006 Frequency and clinical significance of BCR-ABL mutations in patients with chronic myeloid leukemia treated with imatinib mesylate.
16849647 2006 The CML-related oncoprotein BCR/ABL induces expression of histidine decarboxylase (HDC) and the synthesis of histamine in leukemic cells.
16670264 2006 A novel mechanism for BCR-ABL action: stimulated secretion of CCN3 is involved in growth and differentiation regulation.
16631477 2006 A Ph-negative chronic myeloid leukemia with a complex BCR/ABL rearrangement and a t(6;9)(p21;q34.1).
16598834 2006 Generation of the BCR/ABL fusion gene in a Philadelphia chromosome-negative chronic myeloid leukaemia: insertion of 5.6 Mb of 9q34 into the BCR region of chromosome 22.
16596225 2006 Quantitative real-time RT-PCR monitoring of BCR-ABL in chronic myelogenous leukemia shows lack of agreement in blood and bone marrow samples.
16543472 2006 Complex interaction of BCRP/ABCG2 and imatinib in BCR-ABL-expressing cells: BCRP-mediated resistance to imatinib is attenuated by imatinib-induced reduction of BCRP expression.
16502580 2006 Deletion of the derivative chromosome 9 in chronic myeloid leukemia.
16502579 2006 Detection of BCR-ABL mutations and resistance to imatinib mesylate.
16494625 2006 Identification of transcriptional targets associated with the expression of p210 Bcr-Abl.
16490599 2006 The Philadelphia chromosome as a secondary abnormality in inv(3)(q21q26) acute myeloid leukemia at diagnosis: confirmation of p190 BCR-ABL mRNA by real-time quantitative polymerase chain reaction.
16481037 2006 Adaphostin and bortezomib induce oxidative injury and apoptosis in imatinib mesylate-resistant hematopoietic cells expressing mutant forms of Bcr/Abl.
16469868 2006 Bcr-Abl reduces endoplasmic reticulum releasable calcium levels by a Bcl-2-independent mechanism and inhibits calcium-dependent apoptotic signaling.
16449534 2006 Serial measurement of BCR-ABL transcripts in the peripheral blood after allogeneic stem cell transplantation for chronic myeloid leukemia: an attempt to define patients who may not require further therapy.
16442619 2006 Absence of the JAK2 mutation V617F in CD34+ hematopoietic stem and progenitor cells from patients with BCR-ABL-positive CML in chronic phase and blast crisis.
16442529 2006 Bcr interferes with beta-catenin-Tcf1 interaction.
16418324 2006 Inducible activation of CEBPB, a gene negatively regulated by BCR/ABL, inhibits proliferation and promotes differentiation of BCR/ABL-expressing cells.
16264277 2005 Detection of single nucleotide insertion of BCR/ABL region in imatinib-resistant human myelogenous leukemia SR-1 cells.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16116902 2005 [Acute lymphoblastic leukemias with aberrations of BCR-ABL genes].
16079118 2005 e6a2 BCR/ABL1 fusion with cryptic der(9)t(9;22) deletions in a patient with chronic myeloid leukemia.
15968309 2005 [Role of molecular screening for common fusion genes in the diagnosis and classification of leukemia].
15866548 2005 The breakpoint cluster region gene on chromosome 22q11 is associated with bipolar disorder.
15857938 2005 Bcr-Abl regulates osteopontin transcription via Ras, PI-3K, aPKC, Raf-1, and MEK.
15735728 2005 Chronic myeloid leukaemia: an investigation into the role of Bcr-Abl-induced abnormalities in glucose transport regulation.
15723338 2005 Interpretation of submicroscopic deletions of the BCR or ABL gene should not depend on extra signal-FISH: problems in interpretation of submicroscopic deletion of the BCR or ABL gene with extra signal-FISH.
15716990 2005 Derivative chromosome 9 deletions are a significant feature of childhood Philadelphia chromosome positive acute lymphoblastic leukaemia.
15684424 2005 Solution structure of AF-6 PDZ domain and its interaction with the C-terminal peptides from Neurexin and Bcr.
15626746 2005 Identification of mcl-1 as a BCR/ABL-dependent target in chronic myeloid leukemia (CML): evidence for cooperative antileukemic effects of imatinib and mcl-1 antisense oligonucleotides.
15542838 2004 Bcr-Abl-mediated protection from apoptosis downstream of mitochondrial cytochrome c release.
15494376 2004 Bcr (breakpoint cluster region) protein binds to PDZ-domains of scaffold protein PDZK1 and vesicle coat protein Mint3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15481444 2004 Fluorescent in situ hybridization analysis of Philadelphia chromosome-negative chronic myeloid leukemia with the bcr/abl fusion gene.
15389825 2004 Second case of CML with aberrant BCR-ABL fusion transcript (e8/a2) with insertion of an inverted ABL intron 1b sequence.
15302586 2004 The c-Fes tyrosine kinase cooperates with the breakpoint cluster region protein (Bcr) to induce neurite extension in a Rac- and Cdc42-dependent manner.
15248918 2004 [Polymorphism analysis of 5' promotor region of BCR gene].
15145216 2004 Identification of genes differentially regulated by the P210 BCR/ABL1 fusion oncogene using cDNA microarrays.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14993251 2004 The BCR-ABL1 kinase bypasses selection for the expression of a pre-B cell receptor in pre-B acute lymphoblastic leukemia cells.
14966468 2004 Detection of bcr-abl gene expression at a low level in blood cells of some patients with essential thrombocythemia.
14961028 2004 p210BCR/ABL-induced alteration of pre-mRNA splicing in primary human CD34+ hematopoietic progenitor cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14656881 2004 Interferon consensus sequence binding protein (ICSBP; IRF-8) antagonizes BCR/ABL and down-regulates bcl-2.
14654084 2004 Endoplasmic reticulum stress initiates apoptotic death induced by STI571 inhibition of p210 bcr-abl tyrosine kinase.
14581377 2003 Induction of apoptosis by apicidin, a histone deacetylase inhibitor, via the activation of mitochondria-dependent caspase cascades in human Bcr-Abl-positive leukemia cells.
14534537 2003 Leukemia-associated translocation products able to activate RAS modify PML and render cells sensitive to arsenic-induced apoptosis.
12890867 2003 Expression of BCR/ABL and BCL-2 in myeloid progenitors leads to myeloid leukemias.
12821944 2003 Constitutive and specific activation of STAT3 by BCR-ABL in embryonic stem cells.
12808105 2003 The Bcr kinase downregulates Ras signaling by phosphorylating AF-6 and binding to its PDZ domain.
12781448 2003 Amplification of the BCR/ABL fusion gene clustered on a masked Philadelphia chromosome in a patient with myeloblastic crisis of chronic myelocytic leukemia.
12764153 2003 Characterization of a myeloid tyrosine phosphatase, Lyp, and its role in the Bcr-Abl signal transduction pathway.
12734675 2003 Prolonged treatment with imatinib mesylate in patients with advanced chronic myeloid leukemia causes a reduction of bcr/abl mRNA levels independent of cytogenetic response.
12560071 2003 BCR-ABL binds to IRS-1 and IRS-1 phosphorylation is inhibited by imatinib in K562 cells.
12556557 2003 Direct evidence that Bcr-Abl tyrosine kinase activity disrupts normal synergistic interactions between Kit ligand and cytokines in primary primitive progenitor cells.
12522270 2003 Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408765 2002 Clinical significance of dual color-dual fusion translocation fluorescence in situ hybridization in the detection of bcr/abl fusion gene.
12370803 2002 Jak2 is involved in c-Myc induction by Bcr-Abl.
12145699 2002 e19a2-positive chronic myeloid leukaemia with BCR exon e16-deleted transcripts.
12144533 2002 Comprehensive comparison of FISH, RT-PCR, and RQ-PCR for monitoring the BCR-ABL gene after hematopoietic stem cell transplantation in CML.
12115002 1999 Syp Y279, Y304 Can Mediate the Binding of Bcr-Abl to Grb2 and Other Proteins.
12114534 2002 A 76-kb duplicon maps close to the BCR gene on chromosome 22 and the ABL gene on chromosome 9: possible involvement in the genesis of the Philadelphia chromosome translocation.
12096337 2002 p38 MAPK-mediated activation of NF-kappaB by the RhoGEF domain of Bcr.
12023981 2002 The t(4;22)(q12;q11) in atypical chronic myeloid leukaemia fuses BCR to PDGFRA.
11790798 2002 Association of Bcr-Abl with the proto-oncogene Vav is implicated in activation of the Rac-1 pathway.
11780146 2002 Structure of the Bcr-Abl oncoprotein oligomerization domain.
11746971 2001 Fusion of the BCR and the fibroblast growth factor receptor-1 (FGFR1) genes as a result of t(8;22)(p11;q11) in a myeloproliferative disorder: the first fusion gene involving BCR but not ABL.
11726515 2001 Tyrosine phosphorylation of Grb2 by Bcr/Abl and epidermal growth factor receptor: a novel regulatory mechanism for tyrosine kinase signaling.
11376433 2001 Preparation and application of antibodies to phosphoamino acid sequences.
11069024 2000 Cytoplasmic and nuclear localization of the 130 and 160 kDa Bcr proteins.
10887132 2000 The Grb2 binding site is required for the induction of chronic myeloid leukemia-like disease in mice by the Bcr/Abl tyrosine kinase.
10887126 2000 Characterization of Ggrb4, an adapter protein interacting with Bcr-Abl.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
9949177 1999 GCKR links the Bcr-Abl oncogene and Ras to the stress-activated protein kinase pathway.
9874796 1999 The BCR-ABL oncoprotein potentially interacts with the xeroderma pigmentosum group B protein.
9747873 1998 The SH2-containing adapter protein GRB10 interacts with BCR-ABL.
9566916 1998 Protein tyrosine phosphatase 1B antagonizes signalling by oncoprotein tyrosine kinase p210 bcr-abl in vivo.
9467953 1998 Requirement of two specific tyrosine residues for the catalytic activity of Bcr serine/threonine kinase.
9407116 1997 The Src family kinase Hck interacts with Bcr-Abl by a kinase-independent mechanism and phosphorylates the Grb2-binding site of Bcr.
9211920 1997 Interaction of growth hormone-activated STATs with SH2-containing phosphotyrosine phosphatase SHP-1 and nuclear JAK2 tyrosine kinase.
9209414 1997 P210 Bcr-Abl interacts with the interleukin-3 beta c subunit and constitutively activates Jak2.
9178913 1997 Bcr phosphorylated on tyrosine 177 binds Grb2.
9174058 1997 Tyrosine phosphorylation of p120cbl in BCR/abl transformed hematopoietic cells mediates enhanced association with phosphatidylinositol 3-kinase.
9053848 1997 Tyrosine 207 in CRKL is the BCR/ABL phosphorylation site.
8995379 1997 The role of a lymphoid-restricted, Grb2-like SH3-SH2-SH3 protein in T cell receptor signaling.
8955135 1996 Co-expression with BCR induces activation of the FES tyrosine kinase and phosphorylation of specific N-terminal BCR tyrosine residues.
8756631 1996 In vivo and in vitro specificity of protein tyrosine kinases for immunoglobulin G receptor (FcgammaRII) phosphorylation.
8622703 1996 Inhibition of Bcr serine kinase by tyrosine phosphorylation.
8502487 1993 DNA sequence analysis of the major breakpoint cluster region of the BCR gene rearranged in Philadelphia-positive human leukemias.
8453102 1993 Duplication of small segments within the major breakpoint cluster region in chronic myelogenous leukemia.
8204871 1994 No evidence for genomic imprinting of the human BCR gene.
8112292 1994 Bcr-Abl oncoproteins bind directly to activators of the Ras signalling pathway.
7939633 1994 Association of the protein kinases c-Bcr and Bcr-Abl with proteins of the 14-3-3 family.
7724587 1995 Cell cycle-related shifts in subcellular localization of BCR: association with mitotic chromosomes and with heterochromatin.
7665185 1995 Sequence and analysis of the human ABL gene, the BCR gene, and regions involved in the Philadelphia chromosomal translocation.
7529874 1995 Tyrosine phosphorylation of BCR by FPS/FES protein-tyrosine kinases induces association of BCR with GRB-2/SOS.
7506601 1993 A molecular inventory of human pancreatic islets: sequence analysis of 1000 cDNA clones.
6584200 1984 High resolution chromosomes of the t(9;22) positive leukemias.
6319012 1984 Philadelphia chromosomal breakpoints are clustered within a limited region, bcr, on chromosome 22.
6316147 1983 Localization of the c-ab1 oncogene adjacent to a translocation break point in chronic myelocytic leukaemia.
6281890 1982 Isolation of human oncogene sequences (v-fes homolog) from a cosmid library.
3540951 1986 Overlapping cDNA clones define the complete coding region for the P210c-abl gene product associated with chronic myelogenous leukemia cells containing the Philadelphia chromosome.
3463934 1986 Molecular analysis of both translocation products of a Philadelphia-positive CML patient.
3422516 1988 Expression of a distinctive BCR-ABL oncogene in Ph1-positive acute lymphocytic leukemia (ALL).
3285291 1988 bcr genes and transcripts.
3194194 1988 The first BCR gene intron contains breakpoints in Philadelphia chromosome positive leukemia.
3118359 1987 Mapping of four distinct BCR-related loci to chromosome region 22q11: order of BCR loci relative to chronic myelogenous leukemia and acute lymphoblastic leukemia breakpoints.
3107980 1987 cDNA sequence for human bcr, the gene that translocates to the abl oncogene in chronic myeloid leukaemia.
3023859 1986 The chronic myelocytic cell line K562 contains a breakpoint in bcr and produces a chimeric bcr/c-abl transcript.
2989703 1985 Structural organization of the bcr gene and its role in the Ph' translocation.
2989692 1985 Fused transcript of abl and bcr genes in chronic myelogenous leukaemia.
2915904 1989 Alternative 5' end of the bcr-abl transcript in chronic myelogenous leukemia.
2825022 1987 A new fused transcript in Philadelphia chromosome positive acute lymphocytic leukaemia.
2820585 1987 Unique fusion of bcr and c-abl genes in Philadelphia chromosome positive acute lymphoblastic leukemia.
2678002 1989 Structural alterations of the BCR and ABL genes in Ph1 positive acute leukemias with rearrangements in the BCR gene first intron: further evidence implicating Alu sequences in the chromosome translocation.
2407300 1990 Chronic myeloid leukemia may be associated with several bcr-abl transcripts including the acute lymphoid leukemia-type 7 kb transcript.
2263470 1990 Unique organization of the human BCR gene promoter.
2193202 1990 A novel variant of the bcr-abl fusion product in Philadelphia chromosome-positive acute lymphoblastic leukemia.
1903516 1991 Bcr encodes a GTPase-activating protein for p21rac.
1900918 1991 Characterization of the BCR promoter in Philadelphia chromosome-positive and -negative cell lines.
1868241 1991 Entire ABL gene is joined with 5'-BCR in some patients with Philadelphia-positive leukemia.
1763041 1991 Locating protein-coding regions in human DNA sequences by a multiple sensor-neural network approach.
1712671 1991 BCR sequences essential for transformation by the BCR-ABL oncogene bind to the ABL SH2 regulatory domain in a non-phosphotyrosine-dependent manner.
1706781 1991 Reconstruction and analysis of human Alu genes.
1657398 1991 The BCR gene encodes a novel serine/threonine kinase activity within a single exon.
1317490 1992 Amplification and sequencing of genomic breakpoints located within the M-bcr region by Vectorette-mediated polymerase chain reaction.