Property Summary

NCBI Gene PubMed Count 47
PubMed Score 94.52
PubTator Score 64.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma -2.173 2.7e-07
psoriasis -2.000 6.7e-04
ependymoma 1.200 8.6e-04
medulloblastoma 2.600 5.3e-07
atypical teratoid / rhabdoid tumor 1.900 2.6e-06
glioblastoma 1.400 1.6e-03
medulloblastoma, large-cell 2.700 4.8e-06
primitive neuroectodermal tumor 2.100 5.1e-04
pancreatic ductal adenocarcinoma liver m... 1.390 3.1e-03
tuberculosis -1.800 3.7e-04
non-small cell lung cancer -1.002 6.0e-10
intraductal papillary-mucinous adenoma (... 1.300 2.4e-02
intraductal papillary-mucinous carcinoma... 1.700 5.0e-03
intraductal papillary-mucinous neoplasm ... 1.200 2.7e-02
lung cancer 1.200 1.1e-03
pediatric high grade glioma 1.100 1.4e-02
Breast cancer 1.400 2.8e-08
invasive ductal carcinoma 1.200 2.5e-03
ovarian cancer -2.600 2.4e-06

 GO Component (2)

Gene RIF (29)

PMID Text
27000436 Report mutually exclusive BCOR internal tandem duplications and YWHAE-NUTM2 fusions in clear cell sarcoma of kidney.
26752546 The present study further expands the genetic spectrum of small blue round cell tumors, with 2 novel fusions, BCOR-MAML3 and ZC3H7B-BCOR, identified
26573325 Somatic internal tandem duplications (ITDs) clustering in the C terminus of BCOR were found in 85% of pediatric clear cell sarcoma of the kidney. Mutant BCOR transcripts and proteins are markedly upregulated in ITD-positive tumours.
26516930 Data suggest the detection of the partial duplication inside exon 15 of proto-oncogene protein BCOR as part of the diagnostic process of pediatric kidney tumors.
26098867 Data indicate that the internal tandem duplications in the BCOR gene (BCL6 corepressor) affecting the C terminus in 100% (20/20) of clear cell sarcoma of the kidney (CCSK) tumors
26054978 Using reported human BCOR mutations in patients with oculofaciocardiodental syndrome, the authors identified nuclear localization signals at two possible sites; at aa1131-1141 (NLS1) and at aa1158-1167(NLS2).
25596268 study concluded that in pediatric acute myeloid leukemia, BCOR and BCORL1 mutations rarely occur
25490446 findings identify the BCL6/BCOR/SIRT1 complex as a potent repressor of the SHH pathway in normal and oncogenic neural development
25360585 This study adds to recent reports on the clinicopathologic spectrum of BCOR-CCNB3 fusion-positive sarcomas, a newly emerging entity within the undifferentiated unclassified sarcoma category
24805859 Study provides a detailed description of the histologic spectrum, immunohistochemical features, and clinical characteristic of BCOR-CCNB3 sarcoma justifying distinction from Ewing sarcoma with its typical EWS/FUS-ETS translocations.
24694763 The nonsense and frameshift mutations, which introduce premature termination codons, were found to contribute to oculofaciocardiodental syndrome in our two patients.
24285434 ZC3H7B-BCOR and MEAF6-PHF1 fusions occurred predominantly in S100 protein-negative and malignant OFMT.
24146931 two components of a transcriptional repressor complex (BCL-6 and BCoR) of wildtype amino acid sequence can independently or jointly induce the formation of nuclear aggregates when overexpressed.
24047651 Data indicate that sequencing of BCOR and related BCORL1 genes in a cohort of 354 myelodysplastic syndromes (MDS) patients identified 4.2% and 0.8% of mutations respectively.
23557072 report of the clinical and molecular data of 3 new patients with oculofaciocardiodenta and review the literature for all published patients and their mutations in the BCOR gene
23523425 BCL6 corepressor, BCOR, binds the RING finger- and WD40-associated ubiquitin-like (RAWUL) domain of PCGF1 (NSPC1) and PCGF3 but not of PCGF2 (MEL18) or PCGF4 (BMI1).
23074094 FBXL11 inhibited osteo/dentinogenic differentiation potential in MSC cells by associating with BCOR, then increasing histone K4/36 methylation in Epiregulin promoter to repress Epiregulin transcription.
22387997 A new fusion was observed between BCOR (encoding the BCL6 co-repressor) and CCNB3 (encoding the testis-specific cyclin B3) on the X chromosome.
22301464 the mutation in BCOR is likely to be the major determinant for the phenotypes in this Oculofaciocardiodental syndrome (OFCD) family.
22012066 Our results for the first time implicate BCOR in normal karyotype acute myeloid leukemia pathogenesis.
20807888 BCOR is a fusion partner of retinoic acid receptor alpha in a t(X;17)(p11;q12) variant of acute promyelocytic leukemia. BCOR-RARA possesses common features with other RARA fusion proteins.
19578371 Data show that AP-2alpha was identified as a repressive target of BCOR, and BCOR mutation resulted in abnormal activation of AP-2alpha.
18280243 The structure of a BCOR corepressor peptide in complex with the BCL6 BTB domain dimer is reported.
17517692 BCOR left-sided embryonic expression is required for vertebrate laterality determination
16943429 BCOR complex components and mono-ubiquitylated H2A localize to BCL6 targets, indicating that the BCOR complex employs Polycomb Group proteins to expand the repertoire of enzymatic activities that can be recruited by BCL6.
15770227 data confirm that BCOR is the causative gene for oculo-facio-cardio-dental syndrome, two small deletions (c.2488_2489delAG and c.3286delG) and a submicroscopic deletion of about 60 kb encompassing at least BCOR exons 2-15.
15004558 role as a key transcriptional regulator during early embryogenesis
11777915 The forkhead transcription factor AFX activates apoptosis by induction of the BCL-6 transcriptional repressor.
10898795 Function:BCoR is a transcriptional corepressor for BCL-6. Nomenclature:BCoR (BCL-6 corepressor)

AA Sequence

MLSATPLYGNVHSWMNSERVRMCGASEDRKILVNDGDASKARLELREENPLNHNVVDASTAHRIDGLAAL      1 - 70
SMDRTGLIREGLRVPGNIVYSSLCGLGSEKGREAATSTLGGLGFSSERNPEMQFKPNTPETVEASAVSGK     71 - 140
PPNGFSAIYKTPPGIQKSAVATAEALGLDRPASDKQSPLNINGASYLRLPWVNPYMEGATPAIYPFLDSP    141 - 210
NKYSLNMYKALLPQQSYSLAQPLYSPVCTNGERFLYLPPPHYVGPHIPSSLASPMRLSTPSASPAIPPLV    211 - 280
HCADKSLPWKMGVSPGNPVDSHAYPHIQNSKQPRVPSAKAVTSGLPGDTALLLPPSPRPSPRVHLPTQPA    281 - 350
ADTYSEFHKHYARISTSPSVALSKPYMTVSSEFPAARLSNGKYPKAPEGGEGAQPVPGHARKTAVQDRKD    351 - 420
GSSPPLLEKQTVTKDVTDKPLDLSSKVVDVDASKADHMKKMAPTVLVHSRAGSGLVLSGSEIPKETLSPP    421 - 490
GNGCAIYRSEIISTAPSSWVVPGPSPNEENNGKSMSLKNKALDWAIPQQRSSSCPRMGGTDAVITNVSGS    491 - 560
VSSAGRPASASPAPNANADGTKTSRSSVETTPSVIQHVGQPPATPAKHSSSTSSKGAKASNPEPSFKANE    561 - 630
NGLPPSSIFLSPNEAFRSPPIPYPRSYLPYPAPEGIAVSPLSLHGKGPVYPHPVLLPNGSLFPGHLAPKP    631 - 700
GLPYGLPTGRPEFVTYQDALGLGMVHPMLIPHTPIEITKEEKPERRSRSHERARYEDPTLRNRFSEILET    701 - 770
SSTKLHPDVPTDKNLKPNPNWNQGKTVVKSDKLVYVDLLREEPDAKTDTNVSKPSFAAESVGQSAEPPKP    771 - 840
SVEPALQQHRDFIALREELGRISDFHETYTFKQPVFTVSKDSVLAGTNKENLGLPVSTPFLEPPLGSDGP    841 - 910
AVTFGKTQEDPKPFCVGSAPPSVDVTPTYTKDGADEAESNDGKVLKPKPSKLAKRIANSAGYVGDRFKCV    911 - 980
TTELYADSSQLSREQRALQMEGLQEDSILCLPAAYCERAMMRFSELEMKEREGGHPATKDSEMCKFSPAD    981 - 1050
WERLKGNQDKKPKSVTLEEAIAEQNESERCEYSVGNKHRDPFEAPEDKDLPVEKYFVERQPVSEPPADQV   1051 - 1120
ASDMPHSPTLRVDRKRKVSGDSSHTETTAEEVPEDPLLKAKRRRVSKDDWPEREMTNSSSNHLEDPHYSE   1121 - 1190
LTNLKVCIELTGLHPKKQRHLLHLRERWEQQVSAADGKPGRQSRKEVTQATQPEAIPQGTNITEEKPGRK   1191 - 1260
RAEAKGNRSWSEESLKPSDNEQGLPVFSGSPPMKSLSSTSAGGKKQAQPSCAPASRPPAKQQKIKENQKT   1261 - 1330
DVLCADEEEDCQAASLLQKYTDNSEKPSGKRLCKTKHLIPQESRRGLPLTGEYYVENADGKVTVRRFRKR   1331 - 1400
PEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRA   1401 - 1470
ARLGYEEVVLYCLENKICDVNHRDNAGYCALHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVEN   1471 - 1540
DHLEIVRLLLSYGADPTLATYSGRTIMKMTHSELMEKFLTDYLNDLQGRNDDDASGTWDFYGSSVCEPDD   1541 - 1610
ESGYDVLANPPGPEDQDDDDDAYSDVFEFEFSETPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIF   1611 - 1680
RCNFPNVEIVTIAEAEFYRQVSASLLFSCSKDLEAFNPESKELLDLVEFTNEIQTLLGSSVEWLHPSDLA   1681 - 1750
SDNYW                                                                    1751 - 1755
//

Text Mined References (55)

PMID Year Title
27000436 2016 Mutually exclusive BCOR internal tandem duplications and YWHAE-NUTM2 fusions in clear cell sarcoma of kidney: not the full story.
26752546 2016 Novel BCOR-MAML3 and ZC3H7B-BCOR Gene Fusions in Undifferentiated Small Blue Round Cell Sarcomas.
26687479 2015 The variant Polycomb Repressor Complex 1 component PCGF1 interacts with a pluripotency sub-network that includes DPPA4, a regulator of embryogenesis.
26573325 2015 Recurrent internal tandem duplications of BCOR in clear cell sarcoma of the kidney.
26516930 2015 Whole transcriptome sequencing identifies BCOR internal tandem duplication as a common feature of clear cell sarcoma of the kidney.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26098867 2015 Consistent in-frame internal tandem duplications of BCOR characterize clear cell sarcoma of the kidney.
26054978 2015 Identification of nuclear localization signals within the human BCOR protein.
25596268 2015 BCOR and BCORL1 mutations in pediatric acute myeloid leukemia.
25490446 2014 A BCL6/BCOR/SIRT1 complex triggers neurogenesis and suppresses medulloblastoma by repressing Sonic Hedgehog signaling.
25416956 2014 A proteome-scale map of the human interactome network.
25360585 2015 BCOR-CCNB3 fusions are frequent in undifferentiated sarcomas of male children.
25331958 2014 Interferon regulatory factor 8 (IRF8) interacts with the B cell lymphoma 6 (BCL6) corepressor BCOR.
24805859 2014 BCOR-CCNB3 (Ewing-like) sarcoma: a clinicopathologic analysis of 10 cases, in comparison with conventional Ewing sarcoma.
24694763 2014 Oculofaciocardiodental syndrome: novel BCOR mutations and expression in dental cells.
24285434 2014 Novel ZC3H7B-BCOR, MEAF6-PHF1, and EPC1-PHF1 fusions in ossifying fibromyxoid tumors--molecular characterization shows genetic overlap with endometrial stromal sarcoma.
24146931 2013 Overexpression of the transcriptional repressor complex BCL-6/BCoR leads to nuclear aggregates distinct from classical aggresomes.
24047651 2013 BCOR and BCORL1 mutations in myelodysplastic syndromes and related disorders.
23911289 2013 A hybrid mechanism of action for BCL6 in B cells defined by formation of functionally distinct complexes at enhancers and promoters.
23557072 2014 Novel BCOR mutations in patients with oculofaciocardiodental (OFCD) syndrome.
23523425 2013 Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs.
23470693 2013 Genome-wide association studies of pit-and-fissure- and smooth-surface caries in permanent dentition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23074094 2013 Demethylation of epiregulin gene by histone demethylase FBXL11 and BCL6 corepressor inhibits osteo/dentinogenic differentiation.
22387997 2012 A new subtype of bone sarcoma defined by BCOR-CCNB3 gene fusion.
22301464 2012 A family of oculofaciocardiodental syndrome (OFCD) with a novel BCOR mutation and genomic rearrangements involving NHS.
22012066 2011 Whole-exome sequencing identifies somatic mutations of BCOR in acute myeloid leukemia with normal karyotype.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20807888 2010 BCOR as a novel fusion partner of retinoic acid receptor alpha in a t(X;17)(p11;q12) variant of acute promyelocytic leukemia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19578371 2009 BCOR regulates mesenchymal stem cell function by epigenetic mechanisms.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18280243 2008 Structure of a BCOR corepressor peptide in complex with the BCL6 BTB domain dimer.
17517692 2007 Left-sided embryonic expression of the BCL-6 corepressor, BCOR, is required for vertebrate laterality determination.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16943429 2006 Polycomb group and SCF ubiquitin ligases are found in a novel BCOR complex that is recruited to BCL6 targets.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15878880 2005 Transcriptional activity of Sp1 is regulated by molecular interactions between the zinc finger DNA binding domain and the inhibitory domain with corepressors, and this interaction is modulated by MEK.
15770227 2005 Novel mutations in BCOR in three patients with oculo-facio-cardio-dental syndrome, but none in Lenz microphthalmia syndrome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15004558 2004 Oculofaciocardiodental and Lenz microphthalmia syndromes result from distinct classes of mutations in BCOR.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12776190 2003 The mixed lineage leukemia fusion partner AF9 binds specific isoforms of the BCL-6 corepressor.
12522145 2003 Identification of targets for calcium signaling through the copine family of proteins. Characterization of a coiled-coil copine-binding motif.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12116202 2002 Genetic heterogeneity of syndromic X-linked recessive microphthalmia-anophthalmia: is Lenz microphthalmia a single disorder?
11777915 2002 The forkhead transcription factor AFX activates apoptosis by induction of the BCL-6 transcriptional repressor.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10898795 2000 BCoR, a novel corepressor involved in BCL-6 repression.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.