Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.71
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
ependymoma 4679 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 5.6e-11
ovarian cancer 8520 1.4e-06
Disease Target Count Z-score Confidence
psoriasis 6694 0.0 1.10892513065534E-4
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 50 3.352 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 2.000 1.1e-04
osteosarcoma 2.858 5.6e-11
ovarian cancer 1.400 1.4e-06

Synonym

Accession Q8WUZ0 O43770 Q6PD89
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 GO Process (1)

 Compartment GO Term (1)

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MAGRTVRAETRSRAKDDIKKVMATIEKVRRWEKRWVTVGDTSLRIFKWVPVVDPQEEERRRAGGGAERSR      1 - 70
GRERRGRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQP     71 - 140
PRLGQERDPGGITAGSTDEPPMLTKEEPVPELLEAEAPEAYPVFEPVPPVPEAAQGDTEDSEGAPPLKRI    141 - 210
CPNAPDP                                                                   211 - 217
//

Text Mined References (20)

PMID Year Title