Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.71
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
ependymoma 4679 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 5.6e-11
ovarian cancer 8520 1.4e-06
Disease Target Count Z-score Confidence
psoriasis 6694 0.0 1.10892513065534E-4
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 50 3.352 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 2.000 1.1e-04
osteosarcoma 2.858 5.6e-11
ovarian cancer 1.400 1.4e-06

 GO Process (1)

 Compartment GO Term (1)

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MAGRTVRAETRSRAKDDIKKVMATIEKVRRWEKRWVTVGDTSLRIFKWVPVVDPQEEERRRAGGGAERSR      1 - 70
GRERRGRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQP     71 - 140
PRLGQERDPGGITAGSTDEPPMLTKEEPVPELLEAEAPEAYPVFEPVPPVPEAAQGDTEDSEGAPPLKRI    141 - 210
CPNAPDP                                                                   211 - 217
//

Text Mined References (20)

PMID Year Title