Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.88
PubTator Score 5.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7933 2.2e-06
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 45 3.77 1.9
Disease Target Count Z-score Confidence
Supravalvular aortic stenosis 6 3.17 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.544 2.2e-06

Gene RIF (5)

PMID Text
25569233 our data indicate that BCL7B/BCL-7 has some roles in maintaining the structure of nuclei and is involved in the modulation of multiple pathways, including Wnt and apoptosis.
23018576 BCL7B gene deltion is associated with Williams-Beuren Syndrome leading to Burkitt Leukemia.
22082156 Knockdown of B-cell CLL/lymphoma 7B (BCL7B) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20972250 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREP      1 - 70
NGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLG     71 - 140
QEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES            141 - 202
//

Text Mined References (25)

PMID Year Title
25569233 2015 The Tumor Suppressor BCL7B Functions in the Wnt Signaling Pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23018576 2013 Williams-Beuren Syndrome and Burkitt Leukemia.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21300955 2011 Meta-analysis of genome-wide association studies in >80 000 subjects identifies multiple loci for C-reactive protein levels.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20972250 2011 Genetic loci associated with lipid concentrations and cardiovascular risk factors in the Korean population.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18193044 2008 Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9931421 1998 The BCL7 gene family: deletion of BCL7B in Williams syndrome.
9860302 1998 Complete physical map of the common deletion region in Williams syndrome and identification and characterization of three novel genes.
9806765 1998 Isolation of cDNA clones coding for IgE autoantigens with serum IgE from atopic dermatitis patients.
8605326 1996 Molecular cloning of complex chromosomal translocation t(8;14;12)(q24.1;q32.3;q24.1) in a Burkitt lymphoma cell line defines a new gene (BCL7A) with homology to caldesmon.