Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.45
PubTator Score 11.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.100 1.9e-05
psoriasis -1.900 2.0e-04
osteosarcoma -1.177 6.7e-04
posterior fossa group B ependymoma -1.200 2.7e-08
lung cancer 1.800 2.5e-03
sonic hedgehog group medulloblastoma 1.400 1.1e-07
subependymal giant cell astrocytoma -1.878 5.4e-03
acute myeloid leukemia 1.200 1.2e-02
Gaucher disease type 3 1.200 4.8e-03

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (8)

PMID Text
23043359 Report describes BCL7A protein expression in normal lymphoid tissues and lymphomas using immunohistochemistry.
22856870 Data suggest that BCL7A may play an important role in cutaneous T-cell lymphoma (CTCL) carcinogenesis.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19336552 Variants in BCL7A were strongly related to diffuse large B-cell lymphoma.
19336552 Observational study of gene-disease association. (HuGE Navigator)
18663754 deletion of genes BCL7A in early-stage mycosis fungoides.
15897551 Promoter hypermethylation of BCL7a is associated with cutaneous T-cell lymphoma

AA Sequence

MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEK      1 - 70
CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGK     71 - 140
EHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEM    141 - 210
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23043359 2013 BCL7A protein expression in normal and malignant lymphoid tissues.
22856870 2013 Loss of BCL7A expression correlates with poor disease prognosis in patients with early-stage cutaneous T-cell lymphoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19336552 2009 Risk of non-Hodgkin lymphoma associated with germline variation in genes that regulate the cell cycle, apoptosis, and lymphocyte development.
18663754 2008 Array-based comparative genomic hybridization in early-stage mycosis fungoides: recurrent deletion of tumor suppressor genes BCL7A, SMAC/DIABLO, and RHOF.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
15897551 2005 Epigenetic profiling of cutaneous T-cell lymphoma: promoter hypermethylation of multiple tumor suppressor genes including BCL7a, PTPRG, and p73.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9931421 1998 The BCL7 gene family: deletion of BCL7B in Williams syndrome.
8605326 1996 Molecular cloning of complex chromosomal translocation t(8;14;12)(q24.1;q32.3;q24.1) in a Burkitt lymphoma cell line defines a new gene (BCL7A) with homology to caldesmon.