Property Summary

NCBI Gene PubMed Count 86
PubMed Score 100.22
PubTator Score 107.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.200 2.6e-03
astrocytic glioma -1.700 1.5e-02
Astrocytoma, Pilocytic -1.300 5.8e-08
atypical teratoid / rhabdoid tumor -2.700 2.5e-12
colon cancer -1.200 1.0e-03
ependymoma -1.800 1.6e-02
facioscapulohumeral dystrophy 2.100 1.0e-05
glioblastoma -1.700 1.4e-09
group 3 medulloblastoma -2.000 6.8e-07
invasive ductal carcinoma -1.300 5.4e-03
lung adenocarcinoma -1.200 5.4e-08
medulloblastoma, large-cell -2.800 6.6e-08
oligodendroglioma -1.200 5.0e-02
osteosarcoma 1.177 4.6e-05
ovarian cancer 1.200 3.8e-04
primitive neuroectodermal tumor -2.300 7.5e-05
psoriasis 1.300 2.6e-20

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (45)

AA Sequence

MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHV      1 - 70
TPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHS     71 - 140
SGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK                     141 - 193
//

Text Mined References (96)

PMID Year Title