Property Summary

NCBI Gene PubMed Count 9
PubMed Score 11.54
PubTator Score 4.86

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MKSSQTFEEQTECIVNTLLMDFLSPTLQVASRNLCCVDEVDSGEPCSFDVAIIAGRLRMLGDQFNGELEA      1 - 70
SAKNVIAETIKGQTGAILQDTVESLSKTWCAQDSSLAYERAFLAVSVKLLEYMAHIAPEVVGQVAIPMTG     71 - 140
MINGNQAIREFIQGQGGWENLES                                                   141 - 163
//

Text Mined References (10)

PMID Year Title