Property Summary

NCBI Gene PubMed Count 23
PubMed Score 16.26
PubTator Score 13.91

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
23077088 Data indicate that LRP6, BCL2L14, DUSP16, CREBL2, and CDKN1B were involed in centromeric (12p11.21-12p13.2) deletion in ETV6-RUNX1 B-cell precursor acute lymphoblastic leukemia (BCP-ALL).
22573796 Single nucleotide polymorphism in BCL2L14 is associated with lung cancer.
21550398 prior knockdown of Bcl-G expression ablates the stimulation of basal apoptosis by FAU, consistent with an essential downstream role for Bcl-G, itself a candidate tumour suppressor, in mediating the apoptosis regulatory role of FAU.
20855536 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19671159 siRNA downregulation of Bcl-G inhibited breast cancer cell apoptosis. Adding an siRNA against Fau revealed control of Bcl-G by Fau. The most important factors controlling Bcl-G are post-translational modification by Fau & MELK, not transcription rate.
19524489 Increased BclG(L) expression may contribute to the aberrant CD4+ T cell apoptosis which causes an inappropriate immune response and impaired homeostasis in systemic lupus erythematosus.
18006276 JAB1 is involved in the regulation of mitochondrial apoptotic pathway through specific interaction with BclGs.
17557568 data presented here indicate that BH3 domain mutation of the proapoptotic genes Bad, Bmf and Bcl-G is rare in laryngeal squamous cell carcinoma and may not contribute to the apoptosis-resistance mechanisms of laryngeal squamous cell carcinoma
17280616 the kinase activity of MELK is likely to affect mammary carcinogenesis through inhibition of the pro-apoptotic function of Bcl-GL
16484005 There was no somatic mutation of BH3 domains of Bad, Bmf and Bcl-G genes in transitional cell carcinoma samples. The data presented here indicate that BH3 domain mutation of these genes is rare in TCCs and may not contribute to the pathogenesis of TCCs.

AA Sequence

MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEV      1 - 70
SWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQC     71 - 140
LEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILA    141 - 210
KIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTA    211 - 280
KLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD                           281 - 327
//

Text Mined References (24)

PMID Year Title
23077088 2013 Abnormalities of the der(12)t(12;21) in ETV6-RUNX1 acute lymphoblastic leukemia.
22573796 2012 Multistage analysis of variants in the inflammation pathway and lung cancer risk in smokers.
21550398 2011 Candidate tumour suppressor Fau regulates apoptosis in human cells: an essential role for Bcl-G.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19671159 2009 Dysregulated expression of Fau and MELK is associated with poor prognosis in breast cancer.
19524489 2009 Upregulated BclG(L) expression enhances apoptosis of peripheral blood CD4+ T lymphocytes in patients with systemic lupus erythematosus.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18006276 2008 JAB1 accelerates mitochondrial apoptosis by interaction with proapoptotic BclGs.
17557568 Mutational analysis of the BH3 domains of proapoptotic Bcl-2 family genes Bad, Bmf and Bcl-G in laryngeal squamous cell carcinomas.
17280616 2007 Involvement of maternal embryonic leucine zipper kinase (MELK) in mammary carcinogenesis through interaction with Bcl-G, a pro-apoptotic member of the Bcl-2 family.
16484005 2006 BH3 domain mutation of proapoptotic genes Bad, Bmf and Bcl-G is rare in transitional cell carcinomas of the urinary bladder.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15284860 2004 Mutational and expression analysis of the chromosome 12p candidate tumor suppressor genes in pre-B acute lymphoblastic leukemia.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12440815 2002 Bcl-2 expression in preinvasive and invasive cervical lesions.
12136098 2002 NotI flanking sequences: a tool for gene discovery and verification of the human genome.
11896457 2002 A detailed transcriptional map of the chromosome 12p12 tumour suppressor locus.
11054413 2001 Bcl-G, a novel pro-apoptotic member of the Bcl-2 family.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.