Property Summary

Ligand Count 446
NCBI Gene PubMed Count 587
PubMed Score 4028.05
PubTator Score 2249.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.072 3.1e-07
atypical teratoid / rhabdoid tumor 1.100 3.3e-02
COPD -1.400 2.1e-03
ependymoma 2.000 7.3e-03
glioblastoma 1.200 1.5e-02
group 4 medulloblastoma 1.100 1.7e-02
intraductal papillary-mucinous neoplasm ... 1.700 2.3e-03
medulloblastoma, large-cell 1.100 2.7e-03
mucosa-associated lymphoid tissue lympho... 1.130 1.1e-02
oligodendroglioma 1.300 5.3e-03
ovarian cancer 2.500 5.5e-08
psoriasis -1.100 1.8e-03
sarcoidosis 1.100 3.5e-02

Protein-protein Interaction (6)

PDB (67)

Gene RIF (463)

AA Sequence

MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG      1 - 70
HSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI     71 - 140
VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERF    141 - 210
NRWFLTGMTVAGVVLLGSLFSRK                                                   211 - 233
//

Text Mined References (598)

PMID Year Title