Property Summary

NCBI Gene PubMed Count 561
PubMed Score 3877.04
PubTator Score 2249.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
ependymoma 2.200 0.006
oligodendroglioma 1.400 0.001
psoriasis -1.100 0.002
atypical teratoid / rhabdoid tumor 1.500 0.003
glioblastoma 1.200 0.015
group 4 medulloblastoma 1.400 0.004
medulloblastoma, large-cell 1.100 0.003
acute quadriplegic myopathy 1.072 0.000
intraductal papillary-mucinous neoplasm ... 1.700 0.002
COPD -1.400 0.002
mucosa-associated lymphoid tissue lympho... 1.130 0.011
ovarian cancer 2.500 0.000
sarcoidosis 1.100 0.035

Synonym

Accession Q07817 E1P5L6 Q5CZ89 Q5TE65 Q92976 Bcl2-L-1
Symbols BCLX
BCL2L
Bcl-X
PPP1R52
BCL-XL/S

Gene

PANTHER Protein Class (1)

PDB

3R85   2MEJ   4QVE   2YQ6   2YQ7   3FDL   3IO8   4A1U   4A1W   4QVF   5AGW   5AGX   5C3G   2M04   4BPK   4HNJ   4Z9V   1BXL   1G5J   1LXL   1MAZ   1R2D   1R2E   1R2G   1R2H   1R2I   1YSG   1YSI   1YSN   2B48   2LP8   2LPC   2M03   2ME8   2ME9   2O1Y   2O2M   2O2N   2P1L   2PON   2YJ1   2YXJ   3CVA   3FDM   3INQ   3PL7   3QKD   3SP7   3SPF   3WIZ   3ZK6   3ZLN   3ZLO   3ZLR   4AQ3   4C52   4C5D   4CIN   4EHR   4IEH   4PPI   4QVX   4TUH   5FMJ   5FMK  

  Ortholog (13)

MLP Assay (11)

AID Type Active / Inconclusive / Inactive Description
1007 screening 82 / 446 / 194325 Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-XL.
1322 confirmatory 6 / 0 / 828 Multiplexed dose response screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-XL.
2084 confirmatory 0 / 0 / 42 Confirmation dose response of hits from multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-XL
2129 screening 2201 / 0 / 312899 Primary biochemical high throughput screening assay to identify inhibitors of BCL2-related protein, long isoform (BCLXL).
2144 summary 0 / 0 / 0 Summary of probe development efforts to identify inhibitors of BCL2-related protein, long isoform (BCLXL).
2166 screening 922 / 0 / 798 Counterscreen for MCL1 inhibitors: fluorescence polarization-based biochemical high throughput confirmation assay for inhibitors of BCL2-related protein, long isoform (BCLXL).
2218 confirmatory 1 / 0 / 127 Counterscreen for inhibitors of MCL1: fluorescence polarization-based biochemical high throughput dose response assay for inhibitors of BCL2-related protein, long isoform (BCLXL).
2790 confirmatory 0 / 0 / 20 Late stage counterscreen results from the probe development effort to identify MCL1-BIM inhibitors: Fluorescence polarization-based biochemical dose response assay for inhibitors of BCL2-related protein, long isoform (BCLXL)
504627 other 0 / 0 / 0 Bcl-2 family members Fluorescence polarization assay with Set1 of powder compounds
588578 confirmatory 0 / 0 / 58 SAR analysis of selective Bcl-B inhibitors using a Fluorescence Polarization Bcl-XL/Bim-BH3 Assay
More...

Gene RIF (440)

PMID Text
27048913 Genetic and pharmacological inhibition of BCL-W and BCL-XL causes directed elimination of senescent cells.
26763134 Data suggest that regulation of Bax stability and transport between cytosol and mitochondria is more tightly regulated by Bcl-xL/BCL2L1 when Bax has been phosphorylated at Ser184 by AKT1; experiments involved expression in haploid yeast strains.
26731195 Data indicate the potential of functionalized Apt-carbon nanotubes conjugates for increasing the induction of apoptosis in Mucin-1 (MUC1) positive tumor cells by suppression of Bcl-xL transcript.
26462236 TCERG1 sensitizes a cell to apoptotic agents, thus promoting apoptosis by regulating the alternative splicing of both the Bcl-x and Fas/CD95 genes.
26452980 Co-administration of the mTORC1/TORC2 inhibitor INK128 and the Bcl-2/Bcl-xL antagonist ABT-737 kills human myeloid leukemia cells through Mcl-1 down-regulation and AKT inactivation.
26401016 Data suggest BCL2-like 1 protein (BCL2L1) and deleted in liver cancer 1 protein (DLC1) as potential druggable targets for specific subsets of gastric cancer (GC) cases.
26396258 Data show that JAK/STAT signaling inhibition is potentiated by Bcl-xL (B-cell lymphoma-extra large) blockade in interleukin 2 (IL-2) dependent adult T-cell leukemia cells.
26245900 BCL-XL up-regulation by STAT3 contributes to mutant KRAS-mediated apoptosis resistance. Such resistance can be overcome by potent BIM induction and concurrent BCL-XL antagonism
26239225 miR-133a and miR-326 downregulate the mRNA expression of Bcl-xl in HepG2 cells.
26215742 Weakening the inhibition of either Bax or ceramide channels decreased the ability of Bcl-xL to protect cells from apoptosis in a stimulus-dependent manner.
More...

AA Sequence

MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG      1 - 70
HSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI     71 - 140
VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERF    141 - 210
NRWFLTGMTVAGVVLLGSLFSRK                                                   211 - 233
//

Text Mined References (572)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27048913 2016 Directed elimination of senescent cells by inhibition of BCL-W and BCL-XL.
27013495 2016 The deubiquitinase Usp27x stabilizes the BH3-only protein Bim and enhances apoptosis.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26763134 2016 Regulation of Bax/mitochondria interaction by AKT.
26731195 2016 Preparation and evaluation of polyethylenimine-functionalized carbon nanotubes tagged with 5TR1 aptamer for targeted delivery of Bcl-xL shRNA into breast cancer cells.
26462236 2015 Functional Consequences for Apoptosis by Transcription Elongation Regulator 1 (TCERG1)-Mediated Bcl-x and Fas/CD95 Alternative Splicing.
26452980 2015 Co-administration of the mTORC1/TORC2 inhibitor INK128 and the Bcl-2/Bcl-xL antagonist ABT-737 kills human myeloid leukemia cells through Mcl-1 down-regulation and AKT inactivation.
26401016 2015 Genomic alterations in BCL2L1 and DLC1 contribute to drug sensitivity in gastric cancer.
26396258 2015 Selective targeting of JAK/STAT signaling is potentiated by Bcl-xL blockade in IL-2-dependent adult T-cell leukemia.
More...