Property Summary

NCBI Gene PubMed Count 1,540
PubMed Score 123.84
PubTator Score 12509.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count
Chronic lymphoid leukemia, disease 10
Disease Target Count P-value
malignant mesothelioma 3163 7.06860454987987E-10
ovarian cancer 8492 7.92919375654807E-10
pituitary cancer 1972 5.57820200535058E-9
psoriasis 6685 6.96766046064356E-9
medulloblastoma, large-cell 6234 1.76700948529449E-6
lung cancer 4473 3.85865959214253E-6
tuberculosis 1563 1.36158641346145E-4
group 4 medulloblastoma 1875 1.7171995325448E-4
osteosarcoma 7933 0.00135214536066453
primary Sjogren syndrome 789 0.00143778231184675
gastric cancer 436 0.00301119479462898
urothelial carcinoma 318 0.00640339731375656
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00791249914839107
colon cancer 1475 0.00893318706012119
sarcoidosis 368 0.0126025502078281
glioblastoma 5572 0.014805702910037
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0188431672882573
Breast cancer 3099 0.0248609387717636
ductal carcinoma in situ 1745 0.048668866896016
Disease Target Count Z-score Confidence
Immune system cancer 38 0.0 1.0
Lymphoid leukemia 69 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 3.452 1.7
Disease Target Count Z-score Confidence
beta-mannosidosis 9 3.921 2.0

Expression

  Differential Expression (20)

Disease log2 FC p
chronic lymphocytic leukemia 1.534 0.001
gastric cancer 1.200 0.003
urothelial carcinoma -2.000 0.006
malignant mesothelioma 6.100 0.000
psoriasis -1.700 0.000
osteosarcoma -1.824 0.001
glioblastoma -1.100 0.015
medulloblastoma, large-cell -1.900 0.000
tuberculosis 1.700 0.000
intraductal papillary-mucinous carcinoma... -1.800 0.008
intraductal papillary-mucinous neoplasm ... -1.900 0.019
lung cancer -3.600 0.000
colon cancer -2.500 0.009
sarcoidosis 1.100 0.013
Breast cancer 2.500 0.025
group 4 medulloblastoma -1.800 0.000
primary Sjogren syndrome 1.300 0.001
ductal carcinoma in situ -1.200 0.049
ovarian cancer -3.200 0.000
pituitary cancer -3.000 0.000

Synonym

Accession P10415 C9JHD5 P10416 Q13842 Q16197
Symbols Bcl-2
PPP1R50

Gene

PANTHER Protein Class (1)

PDB

5AGW   5AGX   4AQ3   4IEH   1G5M   1GJH   1YSW   2O21   2O22   2O2F   2W3L   2XA0   4LVT   4LXD   4MAN   5FCG  

  Ortholog (10)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
950 screening 116 / 437 / 194222 Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-2.
1328 confirmatory 9 / 0 / 825 Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-2
2075 confirmatory 6 / 0 / 36 Confirmation dose response of hits from multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-2
504627 other 0 / 0 / 0 Bcl-2 family members Fluorescence polarization assay with Set1 of powder compounds

Gene RIF (1440)

PMID Text
27141571 Renal Bcl-2 expression is decreased in diabetes.
27008505 RBP2 promotion of overexpression and activation in acute lymphoblastic leukemia development and progression
26963620 This study examined the immunohistochemical expression of ki-67, p53 and BCL2 in infiltrating lobular breast carcinoma.
26956214 Bcl-2 is required for efficient intestinal transformation.
26884845 Bcl-2 may play a role in vasculogenic mimicry through miRNAs by targeting angiogenesis associated genes in hepatocellular carcinomas.
26884837 MiR-15b can inhibit HepG2 cell proliferation and down-regulate BCL2 mRNA and protein expression.
26881923 These results indicate that the BCL2 -938C>A polymorphism influences the occurrence and course of aseptic loosening.
26874859 Bcl-2 dependent NB cell lines are exquisitely sensitive to ABT-199 . Treatment with ABT-199 displaces Bim from Bcl-2 in NB to activate caspase 3, confirming the restoration of mitochondrial apoptosis
26858413 These observations suggest that HBx may modulate Bcl-2 function in a way that is different from that of the classical BH3-only proteins.
26841249 Authors found a new 28-mer G-quadruplex-forming sequence, P1G4, immediately upstream of the human BCL2 gene P1 promoter.
More...

AA Sequence

MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTS      1 - 70
PLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD     71 - 140
GVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLF    141 - 210
DFSWLSLKTLLSLALVGACITLGAYLGHK                                             211 - 239
//

Text Mined References (1546)

PMID Year Title
27141571 Immunohistochemical Aspects of Cell Death in Diabetic Nephropathy.
27008505 2016 RBP2 Promotes Adult Acute Lymphoblastic Leukemia by Upregulating BCL2.
26963620 2016 Breastfeeding and Immunohistochemical Expression of ki-67, p53 and BCL2 in Infiltrating Lobular Breast Carcinoma.
26956214 2016 Bcl-2 is a critical mediator of intestinal transformation.
26884845 2015 Role of Bcl-2 and its associated miRNAs in vasculogenic mimicry of hepatocellular carcinoma.
26884837 2015 MiR-15b mediates liver cancer cells proliferation through targeting BCL-2.
26881923 2016 The BCL2 -938C>A Promoter Polymorphism Is Associated with Risk for and Time to Aseptic Loosening of Total Hip Arthroplasty.
26874859 2016 Select Bcl-2 antagonism restores chemotherapy sensitivity in high-risk neuroblastoma.
26858413 2016 Structural and biochemical analysis of Bcl-2 interaction with the hepatitis B virus protein HBx.
26841249 2016 A New G-Quadruplex with Hairpin Loop Immediately Upstream of the Human BCL2 P1 Promoter Modulates Transcription.
More...