Property Summary

NCBI Gene PubMed Count 107
PubMed Score 150.96
PubTator Score 138.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
DOID:2627 94 0.0 0.7
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0
Disease Target Count Z-score Confidence
Anemia 365 4.018 2.0
Chromosome 2p16.1-p15 deletion syndrome 8 3.705 1.9
Disease Target Count
Sickle Cell Anemia 53

Expression

  Differential Expression (24)

Disease log2 FC p
Breast cancer -1.600 1.4e-06
adult high grade glioma -2.000 1.3e-02
astrocytic glioma -2.600 3.0e-03
Astrocytoma, Pilocytic -2.800 1.7e-05
atypical teratoid / rhabdoid tumor -2.600 2.3e-04
breast carcinoma -1.100 2.3e-07
colon cancer 1.300 7.9e-05
COPD 1.200 2.9e-02
cutaneous lupus erythematosus -1.100 1.7e-02
ependymoma -3.200 1.7e-03
esophageal adenocarcinoma -1.100 1.8e-02
glioblastoma -1.800 6.3e-04
group 4 medulloblastoma -2.800 1.9e-03
lung cancer 1.800 2.9e-03
lung carcinoma 3.000 2.0e-38
malignant mesothelioma 4.200 4.4e-09
medulloblastoma, large-cell -1.800 3.6e-02
non primary Sjogren syndrome sicca -1.100 5.0e-03
non-small cell lung cancer 1.718 9.3e-11
oligodendroglioma -2.600 6.8e-03
osteosarcoma -2.752 1.1e-05
ovarian cancer 1.700 5.0e-05
psoriasis -1.300 2.0e-03
sarcoidosis 1.600 1.2e-02

Gene RIF (91)

AA Sequence

MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQ      1 - 70
CNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSP     71 - 140
RSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPR    141 - 210
VGIPSGLGAECPSQPPLHGIHIADNNPFNLLRIPGSVSREASGLAEGRFPPTPPLFSPPPRHHLDPHRIE    211 - 280
RLGAEEMALATHHPSAFDRVLRLNPMAMEPPAMDFSRRLRELAGNTSSPPLSPGRPSPMQRLLQPFQPGS    281 - 350
KPPFLATPPLPPLQSAPPPSQPPVKSKSCEFCGKTFKFQSNLVVHRRSHTGEKPYKCNLCDHACTQASKL    351 - 420
KRHMKTHMHKSSPMTVKSDDGLSTASSPEPGTSDLVGSASSALKSVVAKFKSENDPNLIPENGDEEEEED    421 - 490
DEEEEEEEEEEEEELTESERVDYGFGLSLEAARHHENSSRGAVVGVGDESRALPDVMQGMVLSSMQHFSE    491 - 560
AFHQVLGEKHKRGHLAEAEGHRDTCDEDSVAGESDRIDDGTVNGRGCSPGESASGGLSKKLLLGSPSSLS    561 - 630
PFSKRIKLEKEFDLPPAAMPNTENVYSQWLAGYAASRQLKDPFLSFGDSRQSPFASSSEHSSENGSLRFS    631 - 700
TPPGELDGGISGRSGTGSGGSTPHISGPGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPY    701 - 770
KCELCNYACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE         771 - 835
//

Text Mined References (113)

PMID Year Title