Property Summary

NCBI Gene PubMed Count 92
PubMed Score 132.81
PubTator Score 138.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma 4.900 1.9e-09
astrocytic glioma -2.900 7.4e-04
posterior fossa group A ependymoma -3.300 5.4e-11
oligodendroglioma -3.000 1.2e-03
esophageal adenocarcinoma -1.300 2.3e-02
cutaneous lupus erythematosus -1.100 1.7e-02
psoriasis -1.300 2.0e-03
glioblastoma -2.800 1.5e-04
osteosarcoma -3.531 1.4e-03
atypical teratoid / rhabdoid tumor -2.600 2.3e-04
group 4 medulloblastoma -2.800 1.9e-03
medulloblastoma, large-cell -1.800 3.6e-02
non-small cell lung cancer 2.517 2.9e-13
lung cancer 4.700 1.1e-06
colon cancer 1.300 7.9e-05
sarcoidosis 1.600 1.2e-02
adult high grade glioma -2.000 1.3e-02
pilocytic astrocytoma -2.700 2.0e-05
non primary Sjogren syndrome sicca -1.100 5.0e-03
Breast cancer -2.900 6.7e-07
COPD 1.200 2.9e-02
lung carcinoma 3.000 2.0e-38
breast carcinoma -1.100 2.3e-07
ovarian cancer 1.900 2.5e-03

Pathway (1)

Gene RIF (76)

PMID Text
26816381 this study found that LRF/ZBTB7A transcription factor occupies fetal gamma-globin genes and maintains the nucleosome density necessary for gamma-globin gene silencing in adults, and that LRF confers its repressive activity through a NuRD repressor complex independent of the fetal globin repressor BCL11A.
26707798 These data suggest a possible role for BCL11A expression in acute myeloid leukaemia biology
26393293 Association has been found between variants at BCL11A erythroid-specific enhancer and fetal hemoglobin levels among sickle cell disease patients in Cameroon.
26375765 Extensive genetic analyses have validated BCL11A as a potent repressor of fetal hemoglobin level. Studies of BCL11A exemplify how contextual gene regulation may often be the substrate for trait-associated common genetic variation
26342260 only HbF inducer efficient in rescuing the ability to differentiate along the erythroid program, even in K562 cell clones expressing high levels of BCL11A-XL, suggesting that BCL11A-XL activity is counteracted by mithramycin.
26053062 a successful induction of gamma-globin includes a reduction in BCL11A, KLF1 and TAL1 expression.
25938782 the study of these rare patients and orthogonal genetic data demonstrates that BCL11A plays a central role in silencing HbF in humans and implicates BCL11A as an important factor for neurodevelopment
25703683 Common HbF BCL11A enhancer haplotypes in patients with African origin and Arab-Indian sickle cell anemia have similar effects on HbF but they do not explain their differences in HbF.
25574598 BCL11A has an important role in triple-negative breast cancer and normal mammary epithelial cells
25488618 The study compares polymorphism at BCL11A to HBS1L-MYB loci and explains less of the variance in HbF in patients with sickle cell disease in Cameroon.
25457385 Genetic variant in the BCL11A (rs1427407), but not HBS1-MYB (rs6934903) loci associate with fetal hemoglobin levels in Indian sickle cell disease patients.
25457384 SCF-mediated gamma-globin gene expression in adult human erythroid cells is associated with KLF1, BCL11A and SOX6 down-regulation.
25042611 HbA2 levels were associated with SNPs in BCL11A, mediated by the association of this locus with gamma-globin gene expression and fetal hemoglobin levels.
24667352 Genetic variants of BCL11A is associated with sickle cell disease.
24502199 Twelve SNPs at the BCL11A gene were shown to modify HbF levels.
24115442 Genome engineering reveals the enhancer is required in erythroid but not B-lymphoid cells for BCL11A expression.
23975195 Immunohistochemical staining of mouse brain showed strong expression of BCL11A in the cortical regions and also in the pyramidal cell layers in the CA1 and CA3 regions of the hippocampus.
23975195 BCL11A contains F/YSXXLXXL/Y motifs that mediate highly selective binding to the LBDs of orphan nuclear receptors NR2E1/TLX, NR2E3/PNR and the NR2F/COUP-TF family. These motifs are required for BCL11A/COUP-TFII-mediated repression of foetal globin genes and a lncRNA termed Bgl3. The motifs are conserved in other Nuclear receptor cofactors such as NSD1, constituting a new signature motif related to LXXLL and the CoRNR box.
23777413 Data suggest that segregation of BCL11A haplotype 2 indicating an involvement of this locus in Hb F expression.
23758992 BCL11A overexpression predicts survival and relapse in non-small cell lung cancer and is modulated by microRNA-30a and gene amplification.
23576758 BCL11A coordinates the hemoglobin switch and fetal hemoglobin silencing by assembling transcriptional corepressor complexes within the beta-globin cluster.
23541515 The influence of the BCL11A polymorphism on the phenotype of patients with beta thalassemia could be affected by the beta globin locus control region and/or the Xmn1-HBG2 genotypic background.
23438597 The major B cell isoform, BCL11A-XL, binds the RAG1 promoter and Erag enhancer to activate RAG1 and RAG2 transcription in pre-B cells.
23223429 Simvastatin and tBHQ suppress KLF1 and BCL11A gene expression and additively increase fetal hemoglobin in primary human erythroid cells.
23209159 Regulators, including BCL11A,MYB, and KLF1, hold great promise to develop targeted and more effective approaches for HbF induction
23094636 The G>A allele on the rs4671393 locus on chromosome 2 (BCL11A gene), did not show significant association with Hb F levels.
22936743 Studies indicate that single nucleotide polymorphisms (SNPs) in regions of BCL11A and HBS1L-MYB intergenic polymorphism are the major modifiers of HbF in African Americans.
22739175 The C and T polymorphisms are found at the rs11886868 locus of the BCL11A gene in beta-thalassemia patients. The C polymorphism may be related to high Hemoblobin F expression in red blood cells.
22675500 BCL11A is a novel TLX coregulator that might be involved in TLX-dependent gene regulation in the brain.
22271886 Significantly distinct survival curves can be described in beta-thalassemia patients that are attributable to the genetic variants affecting fetal hemoglobin, BCL11A and intergenic HBS1L-MYB loci.
22258351 frequency of rs4671393(G->A) was relatively high in patients with HbE/[beta]-thalassemia of Guangxi province of China, accompanying with high level of HbF; polymorphism of rs4671393 possibly prevents severe complications in patients with HbE/[beta]-thalassemia
22113416 This study indicates a nominal role for JAZF1 and BCL11A variants in type 2 diabetes susceptibility in African-Americans.
21864053 Administration of vascular endothelial growth factor (VEGF)-ZFP-TF may be neuroprotective and has potential as a safe and practical approach for management of motor disability in amyotrophic lateral sclerosis (ALS).
21326311 A novel intronic SNP, rs7606173, associates with F-cell levels in sickle cell patients (P-value <1.81 x 10(-15)).
21267535 no convincing associations were established to the surrogate measurements of beta cell function or insulin sensitivity in this Danish population-based study
21157349 BCL11A is a potent silencer of fetal hemoglobin. It controls the beta-globin gene cluster in concert with other factors.
21068433 Observational study of gene-disease association. (HuGE Navigator)
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20623620 through the interaction with Bcl11A, calcium/calmodulin-dependent serine protein kinase plays a role in axonogenesis, which may be related to brain anatomical characteristics in humans
20578197 A subset of ALL cases bearing 14q32 LOH showed a down-regulation of miRNA 14q32 clusters linked to the submicroscopic chromosomal deletion. This had an inverse correlation with the expression of their target BCL11a.
20575024 characterize the prevalence of REL, BCL11A, and MYCN gains in a consecutive CLL series at the time of diagnosis; (ii) define the prognostic relevance of REL, BCL11A, and MYCN gains in CLL.
20542454 BCL11A is intimately involved in the transcriptional regulation of alpha and beta globins and may also regulate and be regulated by GATA-1 as part of a distinct activator or repressor protein complex.
20472475 SNPs in BCL11A and the HBS1L-MYB region did not show statistically significant correlations with HbFlevels.This suggests that the BCL11A and HBS1L-MYB loci have a minor effect on HbF level compared to the XmnI QTL in beta-thalassemia intermedia patients.
20472475 Observational study of gene-disease association. (HuGE Navigator)
20395365 transcriptional silencing of gamma-globin genes by BCL11A involves long-range interactions and cooperation with SOX6
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20183929 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20075150 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
20018918 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19833888 Observational study of gene-disease association. (HuGE Navigator)
19720844 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19696200 Observational study of gene-disease association. (HuGE Navigator)
19670153 Observational study of gene-disease association. (HuGE Navigator)
19657335 BCL11A is a critical mediator of species-divergent globin switching
19616629 Data report that Bcl11A downregulates axon branching, and that the expression of DCC and MAP1b, two molecules involved in direction and branching of axon outgrowth, is controlled by Bcl11A-L.
19369625 Chronic lymphocytic leukemia With t(2;14)(p16;q32) involves the BCL11A and IgH genes and is associated with atypical morphologic features and unmutated IgVH genes.
19153051 BCL11A binds a core motif in the gamma-globin proximal promoter, recruits and interacts with partners to form a repression complex, leading to deacetylation of histones and down-regulation of gamma-globin transcription.
19056937 down-regulation of BCL11A expression in primary adult erythroid cells leads to robust HbF expression; study finds that BCL11A occupies several discrete sites in the beta-globin gene cluster
19020323 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18948576 deregulated Bcl11a cooperates with Nf1 in leukemogenesis
18854154 Knockdown of B-cell CLL/lymphoma 11A (zinc finger protein, BCL11A) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18714373 Observational study of gene-disease association. (HuGE Navigator)
18691915 Study shows that SNPs in BCL11A were associated with HbF containing erythrocyte numbers in Chinese with beta-thalassemia trait, and with HbF levels in Thais with either beta-thalassemia or HbE trait and in African Americans with sickle cell anemia.
18681895 BCL11A is a SUMOylated protein and recruits SUMO-conjugation enzymes in its nuclear body.
18667698 Observational study of gene-disease association. (HuGE Navigator)
18245381 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18245381 These results indicate that BCL11A variants, by modulating HbF levels, act as an important ameliorating factor of the beta-thalassemia phenotype, and it is likely they could help ameliorate other hemoglobin disorders.
17767159 Genome-wide association study of gene-disease association. (HuGE Navigator)
17672918 the apparent occurrence of an unusual TG 3' splice site in intron 4 is discussed
16871282 essential functional role of this repressor of transcription in primary mediastinal B-cell lymphoma
16704730 The most abundant isoform BCL11A-XL was DNA-sequence-specific transcriptional repressor that associates with itself and with other BCL11A isoforms, as well as with the BCL6 proto-oncogene.
15639232 SIRT1 has a role in transcriptional repression mediated by BCL11A in mammalian cells
11986957 The t(2;14)(p13;q32.3) involving the BCL11A and IGH genes is associated with a subset of B-CLL/immunocytoma characterized by non-mutated IG genes deriving from pre-germinal center B cells.
11830502 BCL11A may not be the target of the 2p13 alterations in cHL(clasical Hodgkins lymphoma),rather REL is.

AA Sequence

MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQ      1 - 70
CNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSP     71 - 140
RSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPR    141 - 210
VGIPSGLGAECPSQPPLHGIHIADNNPFNLLRIPGSVSREASGLAEGRFPPTPPLFSPPPRHHLDPHRIE    211 - 280
RLGAEEMALATHHPSAFDRVLRLNPMAMEPPAMDFSRRLRELAGNTSSPPLSPGRPSPMQRLLQPFQPGS    281 - 350
KPPFLATPPLPPLQSAPPPSQPPVKSKSCEFCGKTFKFQSNLVVHRRSHTGEKPYKCNLCDHACTQASKL    351 - 420
KRHMKTHMHKSSPMTVKSDDGLSTASSPEPGTSDLVGSASSALKSVVAKFKSENDPNLIPENGDEEEEED    421 - 490
DEEEEEEEEEEEEELTESERVDYGFGLSLEAARHHENSSRGAVVGVGDESRALPDVMQGMVLSSMQHFSE    491 - 560
AFHQVLGEKHKRGHLAEAEGHRDTCDEDSVAGESDRIDDGTVNGRGCSPGESASGGLSKKLLLGSPSSLS    561 - 630
PFSKRIKLEKEFDLPPAAMPNTENVYSQWLAGYAASRQLKDPFLSFGDSRQSPFASSSEHSSENGSLRFS    631 - 700
TPPGELDGGISGRSGTGSGGSTPHISGPGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPY    701 - 770
KCELCNYACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE         771 - 835
//

Text Mined References (97)

PMID Year Title
26816381 2016 Transcription factors LRF and BCL11A independently repress expression of fetal hemoglobin.
26707798 2016 BCL11A expression in acute myeloid leukemia.
26393293 2015 Association between Variants at BCL11A Erythroid-Specific Enhancer and Fetal Hemoglobin Levels among Sickle Cell Disease Patients in Cameroon: Implications for Future Therapeutic Interventions.
26375765 2015 Hemoglobin switching's surprise: the versatile transcription factor BCL11A is a master repressor of fetal hemoglobin.
26342260 2015 Development and characterization of K562 cell clones expressing BCL11A-XL: Decreased hemoglobin production with fetal hemoglobin inducers and its rescue with mithramycin.
26053062 2015 Variation in Gamma-Globin Expression before and after Induction with Hydroxyurea Associated with BCL11A, KLF1 and TAL1.
25938782 2015 BCL11A deletions result in fetal hemoglobin persistence and neurodevelopmental alterations.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25703683 2015 BCL11A enhancer haplotypes and fetal hemoglobin in sickle cell anemia.
25574598 2015 BCL11A is a triple-negative breast cancer gene with critical functions in stem and progenitor cells.
25488618 2015 Polymorphism at BCL11A compared to HBS1L-MYB loci explains less of the variance in HbF in patients with sickle cell disease in Cameroon.
25457385 2015 Genetic variant in the BCL11A (rs1427407), but not HBS1-MYB (rs6934903) loci associate with fetal hemoglobin levels in Indian sickle cell disease patients.
25457384 2015 SCF-mediated ?-globin gene expression in adult human erythroid cells is associated with KLF1, BCL11A and SOX6 down-regulation.
25416956 2014 A proteome-scale map of the human interactome network.
25372704 2014 Genome wide association study of fetal hemoglobin in sickle cell anemia in Tanzania.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25042611 2014 The genetics of hemoglobin A2 regulation in sickle cell anemia.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24667352 2014 Association of variants at BCL11A and HBS1L-MYB with hemoglobin F and hospitalization rates among sickle cell patients in Cameroon.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24502199 2014 Genotyping of BCL11A and HBS1L-MYB SNPs associated with fetal haemoglobin levels: a SNaPshot minisequencing approach.
24115442 2013 An erythroid enhancer of BCL11A subject to genetic variation determines fetal hemoglobin level.
23975195 2013 A signature motif mediating selective interactions of BCL11A with the NR2E/F subfamily of orphan nuclear receptors.
23777413 2013 Annotated definition of BCL11A and HMIP-2 haplotypes through the analysis of sicilian ?-thalassemia patients with high levels of fetal hemoglobin.
23758992 2013 BCL11A overexpression predicts survival and relapse in non-small cell lung cancer and is modulated by microRNA-30a and gene amplification.
23646285 2013 Genome-wide association study of HLA-DQB1*06:02 negative essential hypersomnia.
23576758 2013 Corepressor-dependent silencing of fetal hemoglobin expression by BCL11A.
23541515 2013 The influence of the BCL11A polymorphism on the phenotype of patients with beta thalassemia could be affected by the beta globin locus control region and/or the Xmn1-HBG2 genotypic background.
23438597 2013 The BCL11A transcription factor directly activates RAG gene expression and V(D)J recombination.
23406172 2013 Genetic determinants of haemolysis in sickle cell anaemia.
23223429 2013 Simvastatin and t-butylhydroquinone suppress KLF1 and BCL11A gene expression and additively increase fetal hemoglobin in primary human erythroid cells.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23209159 2013 The switch from fetal to adult hemoglobin.
23094636 2012 Influence of BCL11A, HBS1L-MYB, HBBP1 single nucleotide polymorphisms and the HBG2 XmnI polymorphism On Hb F levels.
22936743 2012 Meta-analysis of 2040 sickle cell anemia patients: BCL11A and HBS1L-MYB are the major modifiers of HbF in African Americans.
22739175 2012 [Correlation between hemoglobin F levels and single nucleotide polymorphism at BCL11A gene rs11886868 locus in ?-thalassemia patients].
22675500 2012 The oncoprotein BCL11A binds to orphan nuclear receptor TLX and potentiates its transrepressive function.
22271886 2012 Genetic modifiers of ?-thalassemia and clinical severity as assessed by age at first transfusion.
22258351 2012 Analysis of rs4671393 polymorphism in hemoglobin E/?-thalassemia major in Guangxi Province of China.
22113416 2012 Single nucleotide polymorphisms in JAZF1 and BCL11A gene are nominally associated with type 2 diabetes in African-American families from the GENNID study.
22012869 2011 Genome-wide association study in German patients with attention deficit/hyperactivity disorder.
21864053 2011 Intramuscular administration of a VEGF zinc finger transcription factor activator (VEGF-ZFP-TF) improves functional outcomes in SOD1 rats.
21493818 2011 Genetic and clinical correlates of early-outgrowth colony-forming units.
21326311 2011 Genome-wide association study identifies genetic variants influencing F-cell levels in sickle-cell patients.
21267535 2011 Type 2 diabetes risk allele near CENTD2 is associated with decreased glucose-stimulated insulin release.
21157349 2011 Update on fetal hemoglobin gene regulation in hemoglobinopathies.
21068433 2011 Genetics of fetal hemoglobin in Tanzanian and British patients with sickle cell anemia.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20623620 2010 X-linked mental retardation gene CASK interacts with Bcl11A/CTIP1 and regulates axon branching and outgrowth.
20581827 2010 Twelve type 2 diabetes susceptibility loci identified through large-scale association analysis.
20578197 2010 14q32/miRNA clusters loss of heterozygosity in acute lymphoblastic leukemia is associated with up-regulation of BCL11a.
20575024 2010 Analysis of the REL, BCL11A, and MYCN proto-oncogenes belonging to the 2p amplicon in chronic lymphocytic leukemia.
20542454 2010 Binding patterns of BCL11A in the globin and GATA1 loci and characterization of the BCL11A fetal hemoglobin locus.
20472475 2010 The XmnI (G)gamma polymorphism influences hemoglobin F synthesis contrary to BCL11A and HBS1L-MYB SNPs in a cohort of 57 beta-thalassemia intermedia patients.
20395365 2010 Transcriptional silencing of {gamma}-globin by BCL11A involves long-range interactions and cooperation with SOX6.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20183929 2010 A genome-wide association identified the common genetic variants influence disease severity in beta0-thalassemia/hemoglobin E.
20075150 2010 Utility of genetic and non-genetic risk factors in prediction of type 2 diabetes: Whitehall II prospective cohort study.
20018918 2010 Fetal hemoglobin in sickle cell anemia: genome-wide association studies suggest a regulatory region in the 5' olfactory receptor gene cluster.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
19833888 2010 Gene variants in the novel type 2 diabetes loci CDC123/CAMK1D, THADA, ADAMTS9, BCL11A, and MTNR1B affect different aspects of pancreatic beta-cell function.
19720844 2009 Use of multiple metabolic and genetic markers to improve the prediction of type 2 diabetes: the EPIC-Potsdam Study.
19696200 2009 Amelioration of Sardinian beta0 thalassemia by genetic modifiers.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19670153 2010 Lack of significant effects of the type 2 diabetes susceptibility loci JAZF1, CDC123/CAMK1D, NOTCH2, ADAMTS9, THADA, and TSPAN8/LGR5 on diabetes and quantitative metabolic traits.
19657335 2009 Developmental and species-divergent globin switching are driven by BCL11A.
19616629 2009 Bcl11A/CTIP1 regulates expression of DCC and MAP1b in control of axon branching and dendrite outgrowth.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369625 2009 Chronic lymphocytic leukemia With t(2;14)(p16;q32) involves the BCL11A and IgH genes and is associated with atypical morphologic features and unmutated IgVH genes.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19153051 BCL11A represses HBG transcription in K562 cells.
19056937 2008 Human fetal hemoglobin expression is regulated by the developmental stage-specific repressor BCL11A.
19020323 2008 Genotype score in addition to common risk factors for prediction of type 2 diabetes.
18948576 2009 A retroviral mutagenesis screen reveals strong cooperation between Bcl11a overexpression and loss of the Nf1 tumor suppressor gene.
18714373 2008 Novel meta-analysis-derived type 2 diabetes risk loci do not determine prediabetic phenotypes.
18691915 BCL11A is a major HbF quantitative trait locus in three different populations with beta-hemoglobinopathies.
18681895 2008 BCL11A is a SUMOylated protein and recruits SUMO-conjugation enzymes in its nuclear body.
18667698 2008 DNA polymorphisms at the BCL11A, HBS1L-MYB, and beta-globin loci associate with fetal hemoglobin levels and pain crises in sickle cell disease.
18245381 2008 Genome-wide association study shows BCL11A associated with persistent fetal hemoglobin and amelioration of the phenotype of beta-thalassemia.
17767159 2007 A QTL influencing F cell production maps to a gene encoding a zinc-finger protein on chromosome 2p15.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16871282 2006 Gains of the proto-oncogene BCL11A and nuclear accumulation of BCL11A(XL) protein are frequent in primary mediastinal B-cell lymphoma.
16704730 2006 Functional studies of BCL11A: characterization of the conserved BCL11A-XL splice variant and its interaction with BCL6 in nuclear paraspeckles of germinal center B cells.
15639232 2005 BCL11A-dependent recruitment of SIRT1 to a promoter template in mammalian cells results in histone deacetylation and transcriptional repression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11830502 2002 Recurrent involvement of the REL and BCL11A loci in classical Hodgkin lymphoma.
11719382 2001 The BCL11 gene family: involvement of BCL11A in lymphoid malignancies.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
11161790 2000 Human EVI9, a homologue of the mouse myeloid leukemia gene, is expressed in the hematopoietic progenitors and down-regulated during myeloid differentiation of HL60 cells.
10757802 2000 Evi9 encodes a novel zinc finger protein that physically interacts with BCL6, a known human B-cell proto-oncogene product.
10744719 2000 Isolation of a novel family of C(2)H(2) zinc finger proteins implicated in transcriptional repression mediated by chicken ovalbumin upstream promoter transcription factor (COUP-TF) orphan nuclear receptors.
9847074 1998 Toward a complete human genome sequence.