Property Summary

NCBI Gene PubMed Count 132
PubMed Score 4.24
PubTator Score 303.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.100 3.3e-02
oligodendroglioma -1.600 1.4e-02
primary pancreatic ductal adenocarcinoma 1.114 3.8e-02
intraductal papillary-mucinous carcinoma... 1.200 4.6e-02
intraductal papillary-mucinous neoplasm ... 2.000 1.1e-02
lung cancer -1.700 1.4e-03
pancreatic cancer 1.200 6.4e-06
diabetes mellitus -1.100 1.4e-02
dermatomyositis 1.200 2.7e-03

Gene RIF (78)

PMID Text
26774590 BCL10 is not essential for actin polymerization after fibroblast FcgammaR stimulation.
26771713 BCL10 promoted DNA double-strand breaks repair, enhancing cell survival after DNA damage.
26668357 Data show that caspase recruitment domain-containing protein 11/B-cell CLL/lymphoma 10/mucosa-associated lymphoid tissue lymphoma translocation gene 1 signaling drives lymphoproliferation through NF-kappa B and c-Jun N-terminal kinase activation.
26038114 we identified BCL10 as a bona fide target of BCR-induced linear ubiquitylation and demonstrated an important role of the linear ubiquitin ligase HOIP in BCR-induced phosphorylation
25849213 characterization of zebrafish (Danio rerio) Bcl10
25384343 Overexpression of CARMA-BCL10-MALT in T-ALL may contribute to the constitutive cleavage and inactivation of A20, which enhances NF-kappaB signaling and may be related to T-ALL pathogenesis.
25365219 The results of this study indicate that inherited BCL10 deficiency should be considered in patients with combined immunodeficiency with B cell, T cell, and fibroblast defects.
25105596 BCL10 induces cleavage of MALT1 at R149 in 293T cells.
24732096 BCL10 delivers UBC13 to RNF8/RNF168 to regulate ubiquitination-mediated double-strand break signaling and repair.
24702227 elevated in cholesteatoma
24681956 B-cell lymphoma/leukemia 10 promotes oral cancer progression through STAT1/ATF4/S100P signaling pathway.
24074955 Combining crystallography, nuclear magnetic resonance, and electron microscopy, we reveal the structure of the Bcl10 CARD filament and the mode of interaction between CARMA1 and Bcl10
23784377 A novel susceptibility locus on 1p22 was discovered, which implicates BCL10 as a new susceptibility gene for leprosy.
23530562 BCL10 expression is a useful marker for acinar cell differentiation, particularly in the diagnosis of endoscopic ultrasound-guided fine-needle aspiration specimens of Acinar cell carcinomas of the pancreas
23153494 identify Bcl10 as an early coordinator of NF-kappaB-mediated immune response with endosomal trafficking and signaling to F-actin remodeling
22818167 BCL10 was commonly down-regulated in peripheral T cell lymphomas, suggest the T-cell receptor signaling cascade for future characterization.
22812606 A proapoptotic role for protein kinase C zeta in the binding and phosphorylating Bcl10 at the nuclear envelope.
22708078 Bcl10 links saturated fat overnutrition with hepatocellular NF-kB activation and insulin resistance.
22579587 Results indicate that NF-kappaB binding to the BCL10 promoter can lead to prolonged activation of the carrageenan-induced inflammatory cascade by a transcriptional mechanism involving an NF-kappaB-BCL10 loop.
22564715 BCL10 plays an important role in controlling the growth of cervical cancer cells through NF-kappaB dependent cyclin D1 regulation.
22474286 FOXO3a promotes cell survival via BCL10/NF-kappaB in serum starvation
21896478 identify MIB2 as a novel component of the activated BCL10 signaling complex and a missing link in the BCL10-dependent NF-kappaB signaling pathway.
21700900 findings indicate that BCL10 phosphorylations act upstream of phosphorylations of NIK, TAK1, and IkappaBalpha and differentially affect the canonical and noncanonical pathways of NF-kappaB activation
21674474 Findings demonstrate that CaN functions as a critical signaling molecule during Th cell activation, regulating Bcl-10 phosphorylation and NF-kappaB activation.
21513986 study shows CaMKII is recruited to the immunological synapse where it interacts with and phosphorylates Bcl10; propose a mechanism whereby Ca(2+) signals can be integrated at the immunological synapse through CaMKII-dependent phosphorylation of Bcl10
21406399 Data show that CARMA3 and Bcl10 contributed to several characteristics of EGFR-associated malignancy, including proliferation, survival, migration, and invasion.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20695076 activation of NF-kappaB by CXCR4 occurs through Carma3/Bcl10/Malt1 (CBM) complex in OSCC. loss of components of CBM complex in HNSCC can inhibit SDF-1 alpha induced phosphorylation and degradation of IkappaBalpha.
20466000 Lipopolysaccharide induces activation of both canonical and non-canonical pathways of NF-kappaB and the non-canonical pathway requires phosphorylations of BCL10 (serine 138) and NIK.
20439115 Interaction of calmodulin with Bcl10 modulates NF-kappaB activation.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19897484 These findings indicate an upstream signaling role for BCL10, in addition to its effects on IKKgamma, the regulatory component of the IKK signalosome, and a requirement for BCL10 in both canonical and noncanonical pathways of NF-kappaB activation.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19709433 Results suggest that the NFkappaB regulator BCL10 is an IL-2-independent STAT5 target gene.
19690445 A specific single nucleotide polymorphism in the BCL10 gene may be responsible for the tumorigenesis of intracranial germinomas in Japanese individuals.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19444310 T-cell activation triggers the recruitment of the COP9 signalosome (CSN) to the Carma1-Bcl10-Malt1 (CBM) complex, and CSN downregulation impairs TCR-induced IKK activation.
19336552 Observational study of gene-disease association. (HuGE Navigator)
19309400 Bcl-10 is expressed in peripheral T-cell lymphomas, correlates with PKC theta and Pp65(Ser536) expression and seems to be associated with better survival.
19279678 data suggest that this inherent instability of MALT1-API2 prevents its accumulation and renders a potential effect on MALT lymphoma development via destabilization of BCL10 unlikely
19112107 components of the CBM complex, Carma3, Bcl10, and Malt1 are key mediators of the CXCL8/IL8-induced NFkappaB activation and VEGF up-regulation.
19035248 BCL10 nuclear expression is common in ocular adnexal mucosa-associated lymphoid tissue lymphomas.
18949449 BCL10 nuclear expression and t(11;18)(q21;q21)-positive gastric MALT lymphomas are likely to be related to a failure to respond to H. pylori eradication in Chinese patients.
18806265 analysis of protein domains that mediate interaction between Bcl10 and MALT1
18625728 Data show that the protein kinase C-responsive inhibitory domain of CARD11 functions in NF-kappaB activation to regulate the association of multiple signaling cofactors that differentially depend on Bcl10 and MALT1 for association.
18349075 results further define the molecular mechanisms that control activation of NF-kappaB and reveal a function for A20 in the regulation of CARMA and BCL10 activity in lymphoid and non-lymphoid cells
18346354 The bcl-10 staining was most intense in MALT lymphoma of ocular adnexa
18307945 A novel mutation of Bc1-10 gene in ocular adnexal MALT lymphoma was detected in Chinese patients.
18287044 The regulated ubiquitination of Bcl10 and its recognition by NEMO are a critical link between the Carma1-Bcl10-MALT1 complex, IkappaB kinase recruitment, and NF-kappaB activation.
18252714 Toll-like receptor 4 mediates induction of the Bcl10-NFkappaB-interleukin-8 inflammatory pathway by carrageenan
18231929 BCL10 and MALT1 might not only reflect the lymphocytic origin of H-RS cells, but autonomous activity of this crippled antigen receptor pathway might confer NFB activity and apoptosis resistance 9 at least in those cases of HL expressing wild-type IB.
17893875 Epo has a role in reducing expression of apoptosis-related proteins Bcl-2 and Bcl-10 in ovarian cancer cells
17540779 Identify Bcl10 as a mediator of LPS-induced activation of NK-kappaB and IL-8.
17502353 These findings demonstrate that phosphorylation of Bcl10 at S138 down-regulates Bcl10 protein levels and thus negatively regulates T-cell receptor-mediated NF-kappaB activation.
17371994 These results point to a key role of Bcl10 in F-actin-dependent immune responses of T cells and monocytes/macrophages.
17213322 Mutants of Bcl10 in the IKK phosphorylation site are resistant to degradation
17199743 BCL10 nuclear expression was present in four of 17 cases od MALT lymphoma.
17179215 Bcl10 is a key signaling component mediating NF-kappaB activation induced by GPCRs in nonlymphoid cells.
17101977 CARMA3/Bcl10/MALT1-dependent NF-kappaB activation mediates angiotensin II-responsive inflammatory signaling in hepatocytes.
16831874 Data show that IRAK-1 acts as the essential upstream adaptor that recruits BCL10 to the TLR4 signaling complex and mediates signaling to NF-kappaB through the BCL10-MALT1-TRAF6-TAK1 cascade.
16785131 Heterogeneous BCL10 gene amplification in diffuse large B cell lymphoma cells.
16775419 results reveal a physiological function of cellular inhibitor of apoptosis 2, identify Bcl10 upregulation as a unifying molecular mechanism for mucosa-associated lymphoid tissue lymphomas.
16341151 BCL10 immunohistochemistry is a simple technique to identify those MALT lymphoma cases with an underlying genetic aberration.
16280327 TNFalpha up-regulates the expression of Bcl10 and induces a fraction of Bcl10 nuclear translocation in human breast cancer cells: Akt1, activated by TNFalpha, phosphorylates Bcl10 at Ser218 and Ser231 which complexes with Bcl3 to enter the nucleus
16229939 Observational study of gene-disease association. (HuGE Navigator)
16127295 Accumulation of BCL10 at the perinuclear region is required for the BCL10-mediated NF-kappa B activation.
16123224 nucleocytoplasmic shuttling of MALT1 and BCL10 complex may indicate that these molecules are involved not only in the nuclear factor kappaB (NF-kappaB) pathway but also in other biologic functions in lymphocytes
15878976 The ability of Bcl10 expression to prevent B-cell antigen receptor-induced growth arrest and apoptosis of WEHI-231 cells was dependent on NF-kappaB activation.
15637807 BinCard inhibits BCL10-mediated activation of NF-kappa B.
15207693 Together, these findings suggest that Bcl10 nuclear expression may modulate gene expression and Bcl10 is a potential transcriptional activator apart from its traditional roles that have been found.
14695475 Bcl10 targets NEMO for lysine-63-linked ubiquitination
14674990 Nuclear expression of BCL10 is unlikely to correlate with the API2-MALT1 fusion gene in ocular adnexal MALT lymphoma.
14638696 Bcl10 is post-translationally modified by Rip2 and has a role in T-cell signaling
14523480 association of mutations with aberrant BCL10 localization in the nucleus in nasal NK/T-cell lymphomas
12017308 There is a lack of BCL10 mRNA mutation in lymphold malignancies.
11960389 REVIEW: Genetic alterations involving BCL10 underlying the pathogenesis of MALT lymphoma
11836626 Mutations, relatively common in lymphomas, are extremely rare in malignant cartilaginous tumors.
11830492 vimplicated in apoptosis, and it has been suggested that mutated forms gain oncogenic activity. The occurrence of genomic BCL10 mutations in gastric MALT-type lymphomas was investigated.

AA Sequence

MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLD      1 - 70
YLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDE     71 - 140
SNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGAPPLPPDLQLE    141 - 210
EEGTCANSSEMFLPLRSRTVSRQ                                                   211 - 233
//

Text Mined References (139)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27070702 2016 Targeting Non-proteolytic Protein Ubiquitination for the Treatment of Diffuse Large B Cell Lymphoma.
26774590 2016 Actin polymerisation after FC?R stimulation of human fibroblasts is BCL10 independent.
26771713 2016 BCL10 is recruited to sites of DNA damage to facilitate DNA double-strand break repair.
26668357 2015 Lymphomagenic CARD11/BCL10/MALT1 signaling drives malignant B-cell proliferation via cooperative NF-?B and JNK activation.
26038114 2015 Systems-wide analysis of BCR signalosomes and downstream phosphorylation and ubiquitylation.
25849213 2015 Functional characterization of zebrafish (Danio rerio) Bcl10.
25416956 2014 A proteome-scale map of the human interactome network.
25384343 2014 Characteristics of CARMA1-BCL10-MALT1-A20-NF-?B expression in T cell-acute lymphocytic leukemia.
25365219 2014 Inherited BCL10 deficiency impairs hematopoietic and nonhematopoietic immunity.
25105596 2014 MALT1 auto-proteolysis is essential for NF-?B-dependent gene transcription in activated lymphocytes.
25011391 2014 Combining immunofluorescence with in situ proximity ligation assay: a novel imaging approach to monitor protein-protein interactions in relation to subcellular localization.
24732096 2014 BCL10 regulates RNF8/RNF168-mediated ubiquitination in the DNA damage response.
24702227 2014 Increased expression of Dec-205, Bcl-10, Tim-3, and Trem-1 mRNA in chronic otitis media with cholesteatoma.
24681956 2015 B-cell lymphoma/leukemia 10 promotes oral cancer progression through STAT1/ATF4/S100P signaling pathway.
24412244 2014 Charting the molecular links between driver and susceptibility genes in colorectal cancer.
24074955 2013 Structural architecture of the CARMA1/Bcl10/MALT1 signalosome: nucleation-induced filamentous assembly.
23784377 2013 An association study of TOLL and CARD with leprosy susceptibility in Chinese population.
23661444 2013 Significance of Bcl10 gene mutations in the clinical diagnosis of MALT-type ocular adnexal lymphoma in the Chinese population.
23530562 2013 BCL10 as a useful marker for pancreatic acinar cell carcinoma, especially using endoscopic ultrasound cytology specimens.
23264731 2013 MTR120/KIAA1383, a novel microtubule-associated protein, promotes microtubule stability and ensures cytokinesis.
23153494 2012 The NF-?B signaling protein Bcl10 regulates actin dynamics by controlling AP1 and OCRL-bearing vesicles.
22818167 2012 BCL10 down-regulation in peripheral T-cell lymphomas.
22812606 2012 Role-shifting PKC? fosters its own proapoptotic destruction by complexing with Bcl10 at the nuclear envelope of human cervical carcinoma cells: a proteomic and biochemical study.
22708078 2012 Bcl10 links saturated fat overnutrition with hepatocellular NF-kB activation and insulin resistance.
22579587 2012 Prolongation of carrageenan-induced inflammation in human colonic epithelial cells by activation of an NF?B-BCL10 loop.
22564715 2012 Expression of BCL10 in cervical cancer has a role in the regulation of cell growth through the activation of NF-?B-dependent cyclin D1 signaling.
22528498 2012 Protein kinase C-? negatively regulates T cell receptor-induced NF-?B activation by inhibiting the assembly of CARMA1 signalosome.
22474286 2012 Forkhead transcription factor FOXO3a protein activates nuclear factor ?B through B-cell lymphoma/leukemia 10 (BCL10) protein and promotes tumor cell survival in serum deprivation.
22267217 2012 Dectin-1 is an extracellular pathogen sensor for the induction and processing of IL-1? via a noncanonical caspase-8 inflammasome.
21896478 2011 The E3 ubiquitin ligase mind bomb-2 (MIB2) protein controls B-cell CLL/lymphoma 10 (BCL10)-dependent NF-?B activation.
21700900 2011 Specific effects of BCL10 Serine mutations on phosphorylations in canonical and noncanonical pathways of NF-?B activation following carrageenan.
21674474 2011 Dephosphorylation of Bcl-10 by calcineurin is essential for canonical NF-?B activation in Th cells.
21513986 2011 CaMKII targets Bcl10 in T-cell receptor induced activation of NF-?B.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21406399 2011 CARMA3 is crucial for EGFR-Induced activation of NF-?B and tumor progression.
21269460 2011 Initial characterization of the human central proteome.
21157432 2011 Dephosphorylation of Carma1 by PP2A negatively regulates T-cell activation.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20695076 2009 CXCL12/SDF-1 alpha activates NF-kappaB and promotes oral cancer invasion through the Carma3/Bcl10/Malt1 complex.
20466000 2010 Lipopolysaccharide-induced activation of NF-?B non-canonical pathway requires BCL10 serine 138 and NIK phosphorylations.
20439115 2010 Interaction of calmodulin with Bcl10 modulates NF-kappaB activation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19897484 2010 B-cell CLL/lymphoma 10 (BCL10) is required for NF-kappaB production by both canonical and noncanonical pathways and for NF-kappaB-inducing kinase (NIK) phosphorylation.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19709433 2009 STAT5 regulation of BCL10 parallels constitutive NFkappaB activation in lymphoid tumor cells.
19690445 2009 BCL10 single nucleotide polymorphism and its association with CSF dissemination of primary intracranial germ cell tumors.
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19444310 2009 COP9 signalosome controls the Carma1-Bcl10-Malt1 complex upon T-cell stimulation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19336552 2009 Risk of non-Hodgkin lymphoma associated with germline variation in genes that regulate the cell cycle, apoptosis, and lymphocyte development.
19309400 2009 Bcl-10 protein highly correlates with the expression of phosphorylated p65 NF-kappaB in peripheral T-cell lymphomas and is associated with clinical outcome.
19279678 2009 Auto-ubiquitination-induced degradation of MALT1-API2 prevents BCL10 destabilization in t(11;18)(q21;q21)-positive MALT lymphoma.
19112107 2009 CXCL8/IL8 stimulates vascular endothelial growth factor (VEGF) expression and the autocrine activation of VEGFR2 in endothelial cells by activating NFkappaB through the CBM (Carma3/Bcl10/Malt1) complex.
19035248 2008 [Abnormal BCL10 nuclear expression and chromosomal translocation in ocular adnexal mucosa-associated lymphoid tissue lymphomas].
18949449 2008 BCL10 nuclear expression and t(11;18)(q21;q21) indicate nonresponsiveness to Helicobacter pylori eradication of Chinese primary gastric MALT lymphoma.
18806265 2008 Multiple protein domains mediate interaction between Bcl10 and MALT1.
18625728 2008 The protein kinase C-responsive inhibitory domain of CARD11 functions in NF-kappaB activation to regulate the association of multiple signaling cofactors that differentially depend on Bcl10 and MALT1 for association.
18349075 2008 A20 is a negative regulator of BCL10- and CARMA3-mediated activation of NF-kappaB.
18346354 2007 [Abnormal expression of bcl-10 protein in extranodal marginal zone B cell lymphoma of mucosa-associated lymphoid tissue lymphoma type].
18307945 2007 [Significance of detection of Bcl-10 novel mutation in ocular adnexal mucosa-associated lymphoid tissue lymphoma].
18287044 2008 NEMO recognition of ubiquitinated Bcl10 is required for T cell receptor-mediated NF-kappaB activation.
18264101 2008 The proteolytic activity of the paracaspase MALT1 is key in T cell activation.
18252714 2008 Toll-like receptor 4 mediates induction of the Bcl10-NFkappaB-interleukin-8 inflammatory pathway by carrageenan in human intestinal epithelial cells.
18231929 2008 Analysis of CARMA1/BCL10/MALT1 expression in Reed-Sternberg cells of classical Hodgkin lymphoma.
18223652 2008 T cell antigen receptor stimulation induces MALT1 paracaspase-mediated cleavage of the NF-kappaB inhibitor A20.
17948050 2007 Malt1 ubiquitination triggers NF-kappaB signaling upon T-cell activation.
17893875 2008 Erythropoietin treatment of human ovarian cancer cells results in enhanced signaling and a paclitaxel-resistant phenotype.
17540779 2007 Bcl10 mediates LPS-induced activation of NF-kappaB and IL-8 in human intestinal epithelial cells.
17502353 2007 Phosphorylation of Bcl10 negatively regulates T-cell receptor-mediated NF-kappaB activation.
17468049 2007 Post-translational modifications regulate distinct functions of CARMA1 and BCL10.
17371994 2007 Bcl10 controls TCR- and FcgammaR-induced actin polymerization.
17363905 2007 Phosphorylation and ubiquitination of the IkappaB kinase complex by two distinct signaling pathways.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17287217 2007 Caveolin-1 triggers T-cell activation via CD26 in association with CARMA1.
17213322 2007 Negative feedback loop in T cell activation through IkappaB kinase-induced phosphorylation and degradation of Bcl10.
17199743 2007 MALT1, BCL10 and FOXP1 in salivary gland mucosa-associated lymphoid tissue lymphomas.
17179215 2007 Bcl10 plays a critical role in NF-kappaB activation induced by G protein-coupled receptors.
17101977 2007 CARMA3/Bcl10/MALT1-dependent NF-kappaB activation mediates angiotensin II-responsive inflammatory signaling in nonimmune cells.
17095757 2007 Carrageenan induces interleukin-8 production through distinct Bcl10 pathway in normal human colonic epithelial cells.
17052756 2007 Bcl10 is phosphorylated on Ser138 by Ca2+/calmodulin-dependent protein kinase II.
17047224 2006 Regulation and function of IKK and IKK-related kinases.
16831874 2006 The IRAK-1-BCL10-MALT1-TRAF6-TAK1 cascade mediates signaling to NF-kappaB from Toll-like receptor 4.
16809782 2006 Ca2+/calmodulin-dependent protein kinase II is a modulator of CARMA1-mediated NF-kappaB activation.
16785131 2006 BCL10 gene amplification associated with strong nuclear BCL10 expression in a diffuse large B cell lymphoma with IGH-BCL2 fusion.
16775419 2006 CIAP2 inhibits anigen receptor signaling by targeting Bcl10 for degredation.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16647297 2006 Adaptors discriminate mast-cell cytokine production from eicosanoid production and degranulation.
16395405 2006 cIAP2 is a ubiquitin protein ligase for BCL10 and is dysregulated in mucosa-associated lymphoid tissue lymphomas.
16341151 2006 MALT1 and BCL10 aberrations in MALT lymphomas and their effect on the expression of BCL10 in the tumour cells.
16280327 2006 A pathway for tumor necrosis factor-alpha-induced Bcl10 nuclear translocation. Bcl10 is up-regulated by NF-kappaB and phosphorylated by Akt1 and then complexes with Bcl3 to enter the nucleus.
16229939 2006 Association of BCL10 germ line polymorphisms on chromosome 1p with advanced stage testicular germ cell tumor patients.
16186825 2005 Essential function for the kinase TAK1 in innate and adaptive immune responses.
16127295 2005 Accumulation of BCL10 at the perinuclear region is required for the BCL10-mediated nuclear factor-kappa B activation.
16123224 2005 MALT1 contains nuclear export signals and regulates cytoplasmic localization of BCL10.
15878976 2005 Bcl10 can promote survival of antigen-stimulated B lymphocytes.
15637807 2004 Inhibition of Bcl10-mediated activation of NF-kappa B by BinCARD, a Bcl10-interacting CARD protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15213237 2004 BCL10 mediates lipopolysaccharide/toll-like receptor-4 signaling through interaction with Pellino2.
15207693 2004 Characterization of Bcl10 as a potential transcriptional activator that interacts with general transcription factor TFIIB.
15125833 2004 The TRAF6 ubiquitin ligase and TAK1 kinase mediate IKK activation by BCL10 and MALT1 in T lymphocytes.
15122200 2004 CARMA1, BCL-10 and MALT1 in lymphocyte development and activation.
15082780 2004 Degradation of Bcl10 induced by T-cell activation negatively regulates NF-kappa B signaling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14695475 2004 Bcl10 activates the NF-kappaB pathway through ubiquitination of NEMO.
14674990 2004 No evidence of a correlation between BCL10 expression and API2-MALT1 gene rearrangement in ocular adnexal MALT lymphoma.
14638696 2004 Rip2 participates in Bcl10 signaling and T-cell receptor-mediated NF-kappaB activation.
14523480 2003 BCL10 mutations are irrelevant to its aberrant nuclear localization in nasal NK/T-cell lymphoma.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12154360 2002 CARMA1 is a critical lipid raft-associated regulator of TCR-induced NF-kappa B activation.
11960389 2002 Genetic alterations underlying the pathogenesis of MALT lymphoma.
11830492 2002 BCL10 mutation does not represent an important pathogenic mechanism in gastric MALT-type lymphoma, and the presence of the API2-MLT fusion is associated with aberrant nuclear BCL10 expression.
11472070 2001 CLAN, a novel human CED-4-like gene.
11466612 2001 Interchangeable binding of Bcl10 to TRAF2 and cIAPs regulates apoptosis signaling.
11387339 2001 Bimp1, a MAGUK family member linking protein kinase C activation to Bcl10-mediated NF-kappaB induction.
11356195 2001 Carma1, a CARD-containing binding partner of Bcl10, induces Bcl10 phosphorylation and NF-kappaB activation.
11278692 2001 CARD11 and CARD14 are novel caspase recruitment domain (CARD)/membrane-associated guanylate kinase (MAGUK) family members that interact with BCL10 and activate NF-kappa B.
11262391 2001 Bcl10 and MALT1, independent targets of chromosomal translocation in malt lymphoma, cooperate in a novel NF-kappa B signaling pathway.
11259443 2001 Card10 is a novel caspase recruitment domain/membrane-associated guanylate kinase family member that interacts with BCL10 and activates NF-kappa B.
11238466 2001 Equine herpesvirus protein E10 induces membrane recruitment and phosphorylation of its cellular homologue, bcl-10.
11163238 2001 Bcl10 is a positive regulator of antigen receptor-induced activation of NF-kappaB and neural tube closure.
11113112 2001 vCLAP, a caspase-recruitment domain-containing protein of equine Herpesvirus-2, persistently activates the Ikappa B kinases through oligomerization of IKKgamma.
11090634 2000 Identification of paracaspases and metacaspases: two ancient families of caspase-like proteins, one of which plays a key role in MALT lymphoma.
11053425 2000 CARD9 is a novel caspase recruitment domain-containing protein that interacts with BCL10/CLAP and activates NF-kappa B.
11021819 2000 BCL10 expression in normal and neoplastic lymphoid tissue. Nuclear localization in MALT lymphoma.
10753917 2000 Regulatory mechanisms of TRAF2-mediated signal transduction by Bcl10, a MALT lymphoma-associated protein.
10400625 1999 c-E10 is a caspase-recruiting domain-containing protein that interacts with components of death receptors signaling pathway and activates nuclear factor-kappaB.
10380921 1999 Absence of BCL10 mutations in human malignant mesothelioma.
10364242 1999 CLAP, a novel caspase recruitment domain-containing protein in the tumor necrosis factor receptor pathway, regulates NF-kappaB activation and apoptosis.
10319863 1999 Inactivating mutations and overexpression of BCL10, a caspase recruitment domain-containing gene, in MALT lymphoma with t(1;14)(p22;q32).
10187815 1999 mE10, a novel caspase recruitment domain-containing proapoptotic molecule.
10187771 1999 Equine herpesvirus-2 E10 gene product, but not its cellular homologue, activates NF-kappaB transcription factor and c-Jun N-terminal kinase.
10187770 1999 CIPER, a novel NF kappaB-activating protein containing a caspase recruitment domain with homology to Herpesvirus-2 protein E10.
9989495 1999 Bcl10 is involved in t(1;14)(p22;q32) of MALT B cell lymphoma and mutated in multiple tumor types.
8813110 1996 Loss of heterozygosity analysis defines a critical region in chromosome 1p22 commonly deleted in human malignant mesothelioma.
1040062 1975 [Nurses replies to expectations of the nursing profession].