Property Summary

NCBI Gene PubMed Count 20
PubMed Score 16.24
PubTator Score 16.74

Knowledge Summary

Patent (2,860)

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.100 1.5e-03
ovarian cancer 1.600 4.5e-06
psoriasis 1.600 2.1e-04

Protein-protein Interaction (4)

Gene RIF (7)

AA Sequence

MILASVLRSGPGGGLPLRPLLGPALALRARSTSATDTHHVEMARERSKTVTSFYNQSAIDAAAEKPSVRL      1 - 70
TPTMMLYAGRSQDGSHLLKSARYLQQELPVRIAHRIKGFRCLPFIIGCNPTILHVHELYIRAFQKLTDFP     71 - 140
PIKDQADEAQYCQLVRQLLDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDKTLTSRLGIRMLATHHLAL    141 - 210
HEDKPDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNA    211 - 280
MRATMESHLDTPYNVPDVVITIANNDVDLIIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRISPLFG    281 - 350
HLDMHSGAQSGPMHGFGFGLPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLRHIDGREESFRI            351 - 412
//

Text Mined References (32)

PMID Year Title