Property Summary

NCBI Gene PubMed Count 52
PubMed Score 717.98
PubTator Score 33.60

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (19)

AA Sequence

MAVAIAAARVWRLNRGLSQAALLLLRQPGARGLARSHPPRQQQQFSSLDDKPQFPGASAEFIDKLEFIQP      1 - 70
NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGT     71 - 140
HVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLA    141 - 210
TQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYR    211 - 280
GDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDE    281 - 350
VNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQL    351 - 420
RKQQESLARHLQTYGEHYPLDHFDK                                                 421 - 445
//

Text Mined References (53)

PMID Year Title