Property Summary

NCBI Gene PubMed Count 205
PubMed Score 2133.04
PubTator Score 1889.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Cardiovascular system disease 194 0.0 2.0

Expression

  Differential Expression (29)

Disease log2 FC p
glioblastoma 2.200 1.3e-02
malignant mesothelioma -7.600 2.3e-10
astrocytic glioma 2.500 2.0e-02
oligodendroglioma 2.600 1.8e-02
psoriasis -1.500 7.8e-05
cutaneous lupus erythematosus -2.600 1.9e-03
posterior fossa group A ependymoma -2.000 7.0e-04
cystic fibrosis 2.193 2.6e-06
medulloblastoma, large-cell -2.300 2.5e-03
Atopic dermatitis -1.500 1.3e-04
non-small cell lung cancer -1.739 1.6e-07
intraductal papillary-mucinous adenoma (... -2.900 4.4e-04
intraductal papillary-mucinous carcinoma... -3.100 3.9e-04
intraductal papillary-mucinous neoplasm ... -3.100 5.2e-03
Hydrolethalus syndrome -2.760 1.5e-02
lung cancer 3.200 1.5e-05
colon cancer -3.300 5.5e-07
breast carcinoma -1.300 7.4e-04
fibroadenoma -1.600 1.1e-02
interstitial cystitis -1.600 1.4e-02
lung adenocarcinoma -2.500 7.5e-22
adult high grade glioma 2.100 5.1e-04
group 4 medulloblastoma -2.700 5.3e-06
pilocytic astrocytoma 3.000 9.2e-10
lung carcinoma -1.800 1.4e-08
Pick disease -1.200 8.2e-03
progressive supranuclear palsy -1.100 3.7e-02
invasive ductal carcinoma -2.200 7.0e-03
ovarian cancer -8.300 4.3e-30

 OMIM Phenotype (1)

 CSPA Cell Line (2)

Gene RIF (197)

PMID Text
27468571 Low BChE activity as a predictor of mortality in acute myocardial infarction might be related to its association with poor cardiac function.
26757188 BCHE-K is associated with a reduced risk for Alzheimer disease and Lewy body dementia whereas APOEvarepsilon4 is associated with more rapid cognitive decline.
26497592 rs1803274 polymorphism of the BCHE gene represents a risk factor for in-stent restenosis after percutaneous coronary intervention.
25933219 BChE is a strong predictor for cardiac mortality specifically in younger patients with acute coronary syndrome aged between 45 and 64 years.
25835709 Complement component C3 and butyrylcholinesterase activity are associated with neurodegeneration and clinical disability in multiple sclerosis.
25471831 There is a significant decrease in serum ChE activity after severe trauma
25447891 analysis of the T920C mutation allele frequency in butyrylcholinesterase gene in an Indian population
25336127 High resolution melting analysis for the butyrylcholinesterase atypical variant genotyping is a simple, rapid, sensitive and low cost method
25264279 This study proves that the p.Ala34Val BChE variant determines the "silent" phenotype (unable to hydrolyze succinylcholine and mivacurium).
25179377 There is a link between systemic inflammatory markers, oxidative stress, the PON192rs662-Q allele and BuChE-non-UU-phenotype and their corresponding enzymatic activity which may be considered as a risk factor for the severity of rheumatoid arthritis.
24951323 Data indicate that butyrylcholinesterase (BChE) was significantly associated with overall survival (OS).
24870023 Two mutants of human BCHE can effectively eliminate (-)-cocaine, cocaethylene and norcocaine in simplified kinetic models of cocaine abuse and overdose associated with the concurrent use of cocaine and alcohol.
24479631 BChE-K carriers are protected from the pathological detriments of Alzheimer's disease that affect cortical thickness.
24473115 Plasma arylesterase activity is positively associated with plasma ChE specific activity in a nested case-control study.
24446003 We report the case of a 65-year-old patient who was diagnosed with butyrylcholinesterase resulting in prolonged paralysis and extended mechanical ventilation
24399815 Results indicate that BuChE non-UU phenotype and PON 55M allele are significant risk factors for systemic lupus erythematosus.
24312228 Our findings suggest that the AA genotype of rs1803274 is a risk factor for crack cocaine use, which is more addictive than powder cocaine use.
24125115 CocH3 (BCHE mutant) with an identical concentration with that of the endogenous BChE in human plasma can effectively eliminate both cocaine and norcocaine in a simplified kinetic model of cocaine abuse.
24041656 The present data are still inconclusive with respect to a possible contribution of common genetic variants in BCHE to the pathogenesis of attention-deficit/hyperactivity syndrome.
24001779 BCHE 1914G allele showed higher frequency in the obese group. Carriers of 1914G BCHE allele showed lower mean BChE activity.BCHE 1914G allele is influencing physiological mechanisms related to obesity.
23782236 Water in the active site gorge of the D70G mutant is more easily depleted than that in wild-type BChE.
23689009 These findings show that BCHE can hydrolyze 2-Arachidonoylglycerol which may be evidence of a more specific role for BCHE in endocannabinoid regulation.
23650977 BChE activity might be involved in the pathogenesis of preeclampsia through influence on lipid and lipoprotein metabolism and oxidative stress.
23508960 aspirin is hydrolyzed in plasma by two enzymes, BChE and a new extracellular form of platelet-activating factor acetylhydrolase, PAFAH1b2.
23466605 Data indicate that high AChE affinity of the compounds was achieved by optimizing different substituents on the pyridazinone ring, without sacrificing the AChE/BuChE selectivity profile.
23419831 results confirm the association of APOE with Abeta deposition and represent the largest known effect of BCHE on an AD-related phenotype.
23123771 performed molecular dynamics simulation to probe the structural stability of Indian variant (L307P) in comparison with wild and other BChE variants (D70G, E497V, V142M) having differential esterase activity
23092211 reaction mechanisms and free energy profiles for spontaneous reactivation of wild-type BChE and its G117H mutant phosphorylated by sarin have been explored by performing first-principles quantum mechanical/molecular mechanical free energy calculations; the role of the G117H mutation on the activity has been elucidated
23063927 verify amplification and/or deletion in the ACHE, BCHE, EPHB4 and MME genes in 32 samples of sporadic breast cancer
23044488 designed three BChE peptides by deleting some N- and C-terminal residues of BChE by maintaining the folds of the active site core that includes the three active site residues (S198, E325, and H438)
23022600 The allele, genotype and haplotype frequencies of the K and the -116A variants of BCHE gene were not significantly different between Alzheimer disease cases and controls.
23000450 protective effect of -116A and K variants on juvenile obesity risk, suggesting a role for the BCHE gene on juvenile onset obesity different from that observed on adult onset obesity
22935510 Radioligands targeting unusual BuChE activity in the brain may represent a means for early diagnosis and treatment monitoring of Alzheimer disease.
22922115 Alkylating molecules were synthesized and the crystal structures they form with soman-aged butyrylcholinesterase were solved.
22917637 characterized the catalytic activities of wild-type BChE and the A199S/F227A/S287G/A328 W/Y332G mutant against both (+)- and (-)-cocaine at the same time under the same experimental conditions
22901043 peripheral site of human butyrylcholinesterase
22778864 Elevated levels of BuChE observed in active multiple sclerosis (MS) lesions could be related to the decompaction of myelin characteristic of the disorder.
22750491 [review] Butyrylcholinesterase has diverged both structurally and in terms of tissue and cellular expression patterns from acetylcholinesterase.
22560633 AChE and BChE activities were decreased in prostate cancer patients
22402324 This review examines the roles of gender and BuChE genotype in the phenotypic expression of Alzheimer disease[review]
22331678 BCHE may be involved in the pathogenesis of hepatitis C-related fibrosis among injection drug users.
22294139 Compared with controls, bipolar patients had a significantly higher pseudocholinesterase activity.
22157615 Butyrylcholinesterase is associated with a subpopulation ofbeta-amyloid plaques and may play a role in Alzheimer's disease plaque maturation.
22040426 Serum ChE might be a predictive marker for the prognosis of aged patients with systemic inflammatory response syndrome, with low serum ChE levels indicating poor prognosis.
21862451 Data conclude that variation in BCHE activity is due to multiple variants across the spectrum from uncommon/large effect to common/small effect, and partly results from (rather than causes) metabolic abnormalities.
21576115 Low plasma butyrylcholinesterase activity can be a useful candidate biomarker to identify subjects at greater risk of developing postoperative delirium.
21547979 Despite the geographical coexistence throughout their dispersion, each of these two Amerindian groups retains a high degree of genetic identity, probably maintained by cultural and social isolation.
21530486 significant differences in kinetic pattern and K(i) values between recombinant wild type BChE and F329A mutant suggest that phenylalanine at position 329 in BChE is a critical residue in malachite green and methyl green binding to enzyme
21493754 allelic and haplotype variations in BCHE genes were associated with changes in blood BChE activities; BChE activity was associated with features of the metabolic syndrome
21473860 In this case, an at limits significant result (p=0.03) was obtained for BChE, whose A allele (the K variant) in patients was found associated with higher plasma concentrations of high density lipoprotein-cholesterol.
21454498 BChE reacts preferentially with P(R) enantiomer of V-agents and does not age, in complete contrast to AChE, which is selectively inhibited by the P(S) enantiomer and ages
21402063 Glucose as an independent risk factor for higher BuChE activity in females indicates that BuChE may be a predictor of diabetes.
21029050 eleven of 13 patients with a prolonged duration of action of succinylcholine had mutations in BCHE, indicating that this is the possible reason for a prolonged period of apnea
20886866 mutations on certain nonactive site residues can indirectly affect the catalytic efficiency of the enzyme against (-)-cocaine by enhancing or weakening the overall hydrogen bonding between the oxygen of (-)-cocaine and the oxyanion hole of the enzyme
20883446 Data show that kidney and renal tumours showed comparable levels of acetylcholinesterase mRNA, the content of butyrylcholinesterase mRNA was increased 10-fold in pRCC.
20879632 Pseudocholinesterase deficiency is an inherited or acquired condition in which the metabolism of succinylcholine, mivacurium, or ester local anesthetics is potentially impaired
20807286 Data show that BChE interacts with amylin through its core domain and efficiently attenuates both amylin fibril and oligomer formation.
20677742 mutation-caused shifts of the free energy change from the free enzyme to the rate-determining transition state for (-)-cocaine hydrolysis
20644562 In moderate-to-severe AD (MMSE </=15), presence of the BCHE-K variant was associated with late response to cholinesterase inhibitor treatment
20644562 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20538374 In vitro analysis indicated that high ApoE protein levels were related to an increased pool of dormant BuChE molecules with an abnormally high intrinsic catalytic rate in cerebrospinal fluid, which is "turned on" by excess amyloid beta peptides
20529763 Observational study of gene-disease association. (HuGE Navigator)
20399202 molecular dynamics (MD) simulations on wild-type BuChE (PDB ID: 1P0I) and several known and new variants of this enzyme
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20356562 Surgical pieces of prostatic cancer (PC) and benign prostatic hyperplasia (BPH) were analyzed for AChE and BChE activity.
20308990 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20193849 The majority of the breast tumor tissues showed a notable number of both deletions and amplifications: 65.7% and 22.9%, respectively, in BCHE and 45.7% and 31.4%, respectively, in ACHE.
20143968 may be involved in reducing oxidative stress in diabetic pregnancy
20122907 alterations in BuChE activity in multiple sclerosis white matter lesions
20058037 observed differences in frequency of the BuChE K variant in Alzheimer's disease (AD) and fronto-temporal dementia (FTD) supports the evidence of different molecular pathways involved in the pathogenesis of AD and FTD.
20058037 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20056567 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19713000 ApoE epsilon4 might impart its pathological role through high protein expression and interaction with butyrylcholinesterase, which in turn might modulate central cholinergic activity and amyloidbeta load in the brain.
19685167 The concomitant presences of two alleles of the BCHE-K and APOE-epsilon 4 in increasing the risk of coronary artery disease (CAD) or diabetes in type 2 diabetes mellitus (T2DM) patients with or without CAD and CAD patients without T2DM.
19685167 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19617863 BuChE genotype may have a role in progression from mild cognitive impairment to Alzheimer's disease
19617863 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19481150 These data confirm and extend previous results on the relationship between BChE gene and BuChE activity, and argue rather against a major impact of BuChE on Lewy body disease-associated pathologies.
19481150 Observational study of gene-disease association. (HuGE Navigator)
19474452 Observational study of genetic testing. (HuGE Navigator)
19383604 Dual activity structurally derived changes due to the A539T substitution can account for both neuroprotective characteristics caused by sustained acetylcholine levels and elevated AD risk due to inefficient interference with amyloidogenic processes.
19217865 elastic neutron scattering study of the molecular dynamics of native human butyrylcholinesterase and its "aged" soman-inhibited conjugate revealed a significant change in molecular flexibility on an angstrom-nanosecond scale as a function of temperature
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
19019080 Differences between the t peptides of Aacetylcholinesterase and butyrylcholinesterase are conserved among all vertebrates.
19010318 The results suggest that low butyrylcholinesterase activity may be a nonspecific risk factor for mortality in patients who are on hemodialysis.
19006190 butyrylcholinesterase-K is associated with an increased risk for cognitive decline in Parkinson's disease dementia.
19006190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18780301 SNPs of AChE, BChE, and ChAT genes do not seem to play a relevant role in the response to treatment with the two cholinesterase inhibitors donepezil and rivastigmine.
18780301 Observational study of gene-disease association. (HuGE Navigator)
18778798 The long chain dicholine ester makes closer contact than the short chain ester between one of its carbonyl carbons and the catalytic Ser198, thus explaining why long-chain dicholine esters are hydrolyzed more rapidly by butyrylcholinesterase.
18640242 number of butyrylcholinesterase (BCHE)-K alleles was associated with increasing BuChE activity
18640242 Observational study of gene-disease association. (HuGE Navigator)
18555211 two new mutations of the BCHE gene in 346 Euro-Brazilians
18550040 Observational study of gene-disease association. (HuGE Navigator)
18422653 effects of tyramine, serotonin and benzalkonium on the esterase and aryl acylamidase activities of wild-type butyrylcholinesterase and its peripheral anionic site mutant, D70G, were investigated
18334913 Synergistic effect of apolipoprotein E epsilon4 and butyrylcholinesterase K-variant is associated with disease progression from mild cognitive impairment to Alzheimer's disease
18334913 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18322399 Recombinant human butyrylcholinesterase interacts with beta-amyloid fibrils and can attenuate their formation and branching.
18300943 Gene expression showed that only one of the newly identified mutations (G333C) altered BChE activity, leading to a decrease of about 80% in relation to the wild-type enzyme.
18290843 14-3-3 zeta protein and butyrylcholinesterase (BCHE) synergistic effects between polymorphisms in tau phosphorylation relate-genes may help in determining the risk profile for AD.
18290843 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18237553 a direct association between the reduction of butyrylcholinesterase by the increase of homocysteine and an indirect effect by increase in oxidative stress
18165570 Described denaturing HPLC method to be used for screening for the most common variants of BCHE.
18165570 Observational study of genetic testing. (HuGE Navigator)
18076380 proline-rich peptides organize the 4 subunits of BChE into a 340 kDa tetramer, by interacting with the C-terminal BChE tetramerization domain
18075469 Mutations in the BCHE gene is associated with prolonged duration of action of mivacurium or succinylcholine during anaesthesia
17996334 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17923322 Observational study of gene-disease association. (HuGE Navigator)
17923322 In our population the K variant of BChE is linked to the age of diagnosis of Alzheimer's disease, since AD patients with this allele presented with a later stage. BChE allelic frequencies in our population are higher than those previously reported.
17917325 Serum BChE activity is associated with parameters of adiposity, the serum lipid profile and the degree of insulin resistance in type 2 diabetes .
17852836 data suggest that the BCHE-K allele increases the risk of coronary artery disease in the population (with and without DM) in western parts of Iran, and its presence intensifies the risk of coronary artery disease in type 2 diabetics
17852836 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17768338 Full-length monomeric recombinant BChE has been crystallized for the first time. A 2.8 A X-ray structure was solved in space group P42(1)2, with unit-cell parameters a = b = 156, c = 146 A.
17701416 Observational study of gene-disease association. (HuGE Navigator)
17701416 homozygosity, but not heterozygosity, for BCHE-K is a potential risk factor for the development of NFT pathology in young individuals implicating BCHE-K in the pathogenesis of early AD.
17700357 effects of three non synonymous BCHE mutations (G75R, E90D and /99M) on enzyme kinetic parameters obtained after the expression of the respective recombinant BChEs
17698511 Studied aging pathway for BCHE inhibited by different organophosphates.
17690023 It was concluded that the active sites for esterase and aryl-acylamidase activities are identical, i.e. S198.
17660298 Transgenic goats produced active rBChE in milk sufficient for prophylaxis of humans at risk for exposure to organophosphorus agents
17503475 Observational study of gene-disease association. (HuGE Navigator)
17503475 BChE polymorphisms do not constitute a major genetic risk factor for susceptibility to Alzheimer's disease: in a Sardinian population.
17410321 Alzheimer's disease risk was found affected by interaction between estrogen receptor-alpha and butyrylcholinesterase alleles.
17350607 frequencies of 4 alleles U, A, F, S in Iran of phenotypes of BChE was as follows: normal phenotype (UU) 95.5%, moderate sensitive to succinylcholine including UA,US,UF phenotypes was 3.9%, hypersensitive to succinylcholine (AA, AF, AS, FF, SS) was 0.58%.
17335779 calcium-activated BuchE as a major protective mechanism against suicide inhibition of acetylcholinesterase by organophosphates in this non-neuronal tissue
17318303 Different profiles of cognitive test performance between individuals with silent and wild-type BuChE are observed and suggest a function for BuChE in cognition.
17275003 Observational study of gene-disease association. (HuGE Navigator)
17275003 the 1615G --> A polymorphism BCHE genotype was independently associated with in-stent restenosis in a Japanese population
17192624 Levels are decreased in colonic adenocarcinomas.
17116317 Observational study of gene-disease association. (HuGE Navigator)
16973370 We hypothesize that CSF BuChE varies inversely with BuChE in cortical amyloid plaques. Thus, low BuChE in a patient's CSF may predict extensive incorporation in neuritic plaques, increased neurotoxicity and greater central neurodegeneration.
16962996 H(2)O(2) is a major player in the regulation of the cholinergic signal via both acetylcholinesterase and BchE and this signal is severely affected in the epidermis of patients with active vitiligo
16909200 Down-regulation of butyrylcholinesterase is associated with colorectal carcinoma
16824336 Observational study of gene-disease association. (HuGE Navigator)
16801396 These findings suggest that the Polyethyleneglycol conjugated (PEGylated) recombinant human acetylcholinesterase exhibits unaltered biodistribution and high bioavailability.
16788378 Observational study of genotype prevalence. (HuGE Navigator)
16731619 In Alzheimer's disease, BChE may have thus acquired an inverse role to that of AChE by adopting imperfect amphipathic characteristics of its C terminus
16504521 The hydrolysis of anilides and esters of choline appears to utilize the same catalytic site in BuChE.
16429499 K allele of butyrylcholinesterase in diabetes mellitus, Type 2 may predispose to a higher risk of metabolic syndrome
16298355 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16289064 pharmacokinetics of BuChE were evaluated in guinea pigs and in cynomolgus monkeys
16288482 Effects of the oxyanion hole on the energy barriers provide valuable clues on how to rationally design BChE mutants with a higher catalytic activity for the hydrolysis of cocaine.
16278840 failure to observe increased [(11)C]BMP hydrolysis in vivo makes it less likely that incremental BuChE contributes importantly to acetylcholine hydrolysis in Alzheimer disease
16213467 Human plasma contains four esterases: butyrylcholinesterase, paraoxonase, acetylcholinesterase, and albumin.
16105444 Observational study of gene-disease association. (HuGE Navigator)
16020944 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15907830 The results suggest the involvement of BuChE in the pathophysiological process constituting the metabolic syndrome.
15834019 Observational study of gene-disease association. (HuGE Navigator)
15802910 Observational study of gene-disease association. (HuGE Navigator)
15802910 BuChE may play role in the phosphorylation of tau in Alzheimer disease
15781196 Observational study of genotype prevalence. (HuGE Navigator)
15781196 four new mutations, found in the exon 2 of the BCHE gene, in a sample from 3001 Brazilian blood donors.A table with the 58 non-usual variants of butyrylcholinesterase is also presented
15731585 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15696543 compareison of theoretical results with those from previous work on mouse acetylcholinesterase and discussion of their implications for substrate binding and catalysis in BuChE.
15690550 Observational study of gene-disease association. (HuGE Navigator)
15519745 Observational study of gene-disease association. (HuGE Navigator)
15519745 BChE-K variant and ApoE-epsilon 4 alleles act synergistically to increase the risk of late-onset Alzheimer's disease, particularly in age group <75 years in Tehran, Iran.
15465921 When genetically transferred into rats, accelerated cocaine metabolism.
15449725 Both bambuterol and terbutaline inhibit BChE, but their affinities differ in human serum BChE variants.
15386241 Observational study of gene-disease association. (HuGE Navigator)
15386241 This study reports the first data on the relation of BCHE alleles to anthropometric characters.
15258737 Observational study of gene-disease association. (HuGE Navigator)
15258737 BCHE K polymorphism is associated with Type 2 diabetes or with estimates of pancreatic beta cell function in large-scale Danish Caucasian populations.
15111428 analysis of global dynamics of human butyrylcholinesterase in solvents
14735258 Observational study of gene-disease association. (HuGE Navigator)
14686935 Theoretical analysis of the oscillatory behaviour of the approach to the steady-state for BuChE led us to propose a model for the hysteresis of BuChE with Benzoylcholine.
14622273 replacement of Ala277(Trp279) with Trp in human BChE does not affect the binding of E2020 to BChE
12901493 Observational study of gene-disease association. (HuGE Navigator)
12881446 Observational study of gene-disease association. (HuGE Navigator)
12869558 the structure of BChE is similar to a previously published theoretical model of this enzyme and to the structure of Torpedo acetylcholinesterase
12811800 The distinct distribution of BuChE activity in neurons in the human thalamus is consistent with an important role for this enzyme in neurotransmission in the human nervous system.
12724618 Observational study of gene-disease association. (HuGE Navigator)
12724618 Data help to better define the etiology of low BChE activity and the role of the rather common K allele
12687586 Observational study of genotype prevalence. (HuGE Navigator)
12668920 Butyrylcholinesterase is a major regulator of attention especially in cholinergic deficiency states through its ability to hydrolyse acetylcholine.
12417112 Novel mutation and multiple mutations found in the human butyrylcholinesterase gene affect enzyme activity.
12387584 Observational study of genetic testing. (HuGE Navigator)
12130740 Wild-type and A328W mutant expressed in Chinese hamster ovary cells have a 16-hour half-life in the circulation and protect mice from cocaine toxicity.
12074828 Observational study of gene-disease association. (HuGE Navigator)
12074828 There is a minor association between BChE-K and early-onset coronary artery disease, especially in the presence of the APOE-epsilon 4 allele
12044901 BuChE-catalyzed hydrolysis of N-methylindoxyl acetate: analysis of volume changes upon reaction and hysteretic behavior. Hydrolysis by wild-type BuChE and peripheral site mutants (D70G, Y332A, D70G/Y332A) was found to follow Michaelis-Menten kinetics.
12009429 serum enzyme inhibited by antidepressants, fluoxetine, sertraline and amitriptyline, in a dose related manner
11856351 Human butyrylcholinesterase is reversibly inhibited by tetraethylammonium ion.
11856322 Engineering of a monomeric and low-glycosylated form
11849755 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11848688 can hydrolyze acetylcholine in the normal and Alzheimer brain.
11793025 Observational study of gene-disease association. (HuGE Navigator)
11793025 Butyrylcholinesterase K variant on chromosome 3 q is associated with Type II diabetes in white Caucasian subjects.
11749053 Mutations associated with prolonged neuromuscular block during anesthesia.
11738493 Meta-analysis of gene-disease association. (HuGE Navigator)
11725818 Observational study of gene-disease association. (HuGE Navigator)
11436125 Observational study of gene-disease association. (HuGE Navigator)
11125748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLR      1 - 70
FKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIW     71 - 140
IYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQLALQWVQKNI    141 - 210
AAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGC    211 - 280
SRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVN    281 - 350
KDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDV    351 - 420
VGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDNYTKAEEI    421 - 490
LSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKVLEM    491 - 560
TGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL                                561 - 602
//

Text Mined References (232)

PMID Year Title
27468571 2016 Low Serum-Butyrylcholinesterase Activity as a Prognostic Marker of Mortality Associates with Poor Cardiac Function in Acute Myocardial Infarction.
26922910 2016 Unexpected Reaction Pathway for butyrylcholinesterase-catalyzed inactivation of "hunger hormone" ghrelin.
26757188 2016 Association of Butyrylcholinesterase-K Allele and Apolipoprotein E ?4 Allele with Cognitive Decline in Dementia with Lewy Bodies and Alzheimer's Disease.
26497592 2015 The rs1803274 polymorphism of the BCHE gene is associated with an increased risk of coronary in-stent restenosis.
25933219 2015 Butyrylcholinesterase predicts cardiac mortality in young patients with acute coronary syndrome.
25835709 2015 Complement component C3 and butyrylcholinesterase activity are associated with neurodegeneration and clinical disability in multiple sclerosis.
25471831 2014 Dynamic changes of serum cholinesterase activity after severe trauma.
25448037 2015 Review of human butyrylcholinesterase structure, function, genetic variants, history of use in the clinic, and potential therapeutic uses.
25447891 2015 The allele frequency of T920C mutation in butyrylcholinesterase gene is high in an Indian population.
25336127 [Rapid detection of BCHE atypical variant (p.Asp70Gly) by high resolution melting curve analysis].
25264279 2014 Characterization of a novel butyrylcholinesterase point mutation (p.Ala34Val), "silent" with mivacurium.
25179377 2015 Association between butyrylcholinesterase activity and phenotypes, paraoxonase192 rs662 gene polymorphism and their enzymatic activity with severity of rheumatoid arthritis: correlation with systemic inflammatory markers and oxidative stress, preliminary report.
25054547 2014 Characterization of a novel BCHE "silent" allele: point mutation (p.Val204Asp) causes loss of activity and prolonged apnea with suxamethonium.
24951323 2014 Significance of preoperative butyrylcholinesterase as an independent predictor of survival in patients with muscle-invasive bladder cancer treated with radical cystectomy.
24870023 2014 Kinetic characterization of human butyrylcholinesterase mutants for the hydrolysis of cocaethylene.
24479631 2014 Butyrylcholinesterase K and apolipoprotein ?4 affect cortical thickness and neuropsychiatric symptoms in Alzheimer's disease.
24473115 2014 Arylesterase phenotype-specific positive association between arylesterase activity and cholinesterase specific activity in human serum.
24446003 2014 [Residual relaxant block due to pseudocholinesterase deficiency - First manifestation in an elderly patient].
24399815 2014 Synergistic effects of BuChE non-UU phenotype and paraoxonase (PON1) 55 M allele on the risk of systemic lupus erythematosus: influence on lipid and lipoprotein metabolism and oxidative stress, preliminary report.
24312228 2013 Butyrylcholinesterase genetic variants: association with cocaine dependence and related phenotypes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24125115 2014 Kinetic characterization of high-activity mutants of human butyrylcholinesterase for the cocaine metabolite norcocaine.
24041656 2013 Acetylcholine-metabolizing butyrylcholinesterase (BCHE) copy number and single nucleotide polymorphisms and their role in attention-deficit/hyperactivity syndrome.
24001779 2013 1914G variant of BCHE gene associated with enzyme activity, obesity and triglyceride levels.
23782236 2013 Effects of viscosity and osmotic stress on the reaction of human butyrylcholinesterase with cresyl saligenin phosphate, a toxicant related to aerotoxic syndrome: kinetic and molecular dynamics studies.
23689009 2013 2-Arachidonoylglycerol is a substrate for butyrylcholinesterase: A potential mechanism for extracellular endocannabinoid regulation.
23679855 2013 Crystal structures of human cholinesterases in complex with huprine W and tacrine: elements of specificity for anti-Alzheimer's drugs targeting acetyl- and butyryl-cholinesterase.
23650977 2013 Butyrylcholinesterase (BChE) activity is associated with the risk of preeclampsia: influence on lipid and lipoprotein metabolism and oxidative stress.
23508960 2013 Aspirin hydrolysis in plasma is a variable function of butyrylcholinesterase and platelet-activating factor acetylhydrolase 1b2 (PAFAH1b2).
23466605 2013 Discovery of novel 2,6-disubstituted pyridazinone derivatives as acetylcholinesterase inhibitors.
23419831 2014 APOE and BCHE as modulators of cerebral amyloid deposition: a florbetapir PET genome-wide association study.
23123771 2013 An Indian butyrylcholinesterase variant L307P is not structurally stable: a molecular dynamics simulation study.
23092211 2012 Why does the G117H mutation considerably improve the activity of human butyrylcholinesterase against sarin? Insights from quantum mechanical/molecular mechanical free energy calculations.
23063927 2013 Copy number variation in ACHE/EPHB4 (7q22) and in BCHE/MME (3q26) genes in sporadic breast cancer.
23044488 2013 Amino acid residues at the N- and C-termini are essential for the folding of active human butyrylcholinesterase polypeptide.
23022600 2013 Association analysis between K and -116A variants of butyrylcholinesterase and Alzheimer's disease in a Brazilian population.
23000450 2013 -116A and K BCHE gene variants associated with obesity and hypertriglyceridemia in adolescents from Southern Brazil.
22935510 2013 Butyrylcholinesterase radioligands to image Alzheimer's disease brain.
22922115 2013 A step toward the reactivation of aged cholinesterases--crystal structure of ligands binding to aged human butyrylcholinesterase.
22917637 2013 Catalytic activities of a cocaine hydrolase engineered from human butyrylcholinesterase against (+)- and (-)-cocaine.
22901043 2012 Probing the peripheral site of human butyrylcholinesterase.
22778864 2011 Cysteine thioesters as myelin proteolipid protein analogues to examine the role of butyrylcholinesterase in myelin decompaction.
22750491 2012 Why has butyrylcholinesterase been retained? Structural and functional diversification in a duplicated gene.
22726956 2012 Human butyrylcholinesterase produced in insect cells: huprine-based affinity purification and crystal structure.
22560633 2012 Cholinesterase activities and biochemical determinations in patients with prostate cancer: influence of Gleason score, treatment and bone metastasis.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22444575 2012 Identification of phosphorylated butyrylcholinesterase in human plasma using immunoaffinity purification and mass spectrometry.
22402324 2013 Butyrylcholinesterase genotype and gender influence Alzheimer's disease phenotype.
22331678 2012 Laser captured hepatocytes show association of butyrylcholinesterase gene loss and fibrosis progression in hepatitis C-infected drug users.
22294139 [Pseudocholinesterase activity in type 1 bipolar patients].
22157615 2012 Butyrylcholinesterase is associated with ?-amyloid plaques in the transgenic APPSWE/PSEN1dE9 mouse model of Alzheimer disease.
22040426 2011 Predictive value of serum cholinesterase for the prognosis of aged patients with systemic inflammatory response syndrome.
21943158 2011 Genetic variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits.
21862451 2011 GWAS of butyrylcholinesterase activity identifies four novel loci, independent effects within BCHE and secondary associations with metabolic risk factors.
21576115 2011 Low preoperative plasma cholinesterase activity as a risk marker of postoperative delirium in elderly patients.
21547979 Variability of the BCHE gene in Amerindians from ParanĂ¡, Brazil.
21530486 2011 The role of Phe329 in binding of cationic triarylmethane dyes to human butyrylcholinesterase.
21493754 2011 Naturally occurring variations in the human cholinesterase genes: heritability and association with cardiovascular and metabolic traits.
21473860 2011 Variation of the butyrylcholinesterase (BChE) and acetylcholinesterase (AChE) genes in coronary artery disease.
21454498 2011 Structural study of the complex stereoselectivity of human butyrylcholinesterase for the neurotoxic V-agents.
21402063 2011 Butyrylcholinesterase activity in young men and women: association with cardiovascular risk factors.
21029050 2011 Butyrylcholinesterase gene mutations in patients with prolonged apnea after succinylcholine for electroconvulsive therapy.
20946535 2011 Biochemical, molecular and preclinical characterization of a double-virus-reduced human butyrylcholinesterase preparation designed for clinical use.
20886866 2010 Design of high-activity mutants of human butyrylcholinesterase against (-)-cocaine: structural and energetic factors affecting the catalytic efficiency.
20883446 2010 Expression of cholinesterases in human kidney and its variation in renal cell carcinoma types.
20879632 2010 Pseudocholinesterase deficiency: a comprehensive review of genetic, acquired, and drug influences.
20807286 2011 Butyrylcholinesterase interactions with amylin may protect pancreatic cells in metabolic syndrome.
20677742 2010 Free energy perturbation simulation on transition states and high-activity mutants of human butyrylcholinesterase for (-)-cocaine hydrolysis.
20644562 2011 Effect of apolipoprotein E and butyrylcholinesterase genotypes on cognitive response to cholinesterase inhibitor treatment at different stages of Alzheimer's disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20538374 2011 Differential levels of apolipoprotein E and butyrylcholinesterase show strong association with pathological signs of Alzheimer's disease in the brain in vivo.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20445134 2010 Association of genome-wide variation with the risk of incident heart failure in adults of European and African ancestry: a prospective meta-analysis from the cohorts for heart and aging research in genomic epidemiology (CHARGE) consortium.
20399202 2010 Butyrylcholinesterase and G116H, G116S, G117H, G117N, E197Q and G117H/E197Q mutants: a molecular dynamics study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20356562 2010 Analysis of cholinesterases in human prostate and sperm: implications in cancer and fertility.
20308990 2011 Genome-wide copy number variation analysis in attention-deficit/hyperactivity disorder: association with neuropeptide Y gene dosage in an extended pedigree.
20193849 2010 Amplification and deletion of the ACHE and BCHE cholinesterase genes in sporadic breast cancer.
20143968 2010 Butyrylcholinesterase activity in women with diabetes mellitus in pregnancy: correlation with antioxidant activity.
20122907 2010 Butyrylcholinesterase activity in multiple sclerosis neuropathology.
20058037 2010 BuChE K variant is decreased in Alzheimer's disease not in fronto-temporal dementia.
20056567 2010 Childhood brain tumors, residential insecticide exposure, and pesticide metabolism genes.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19713000 2011 The apolipoprotein E ?4 allele plays pathological roles in AD through high protein expression and interaction with butyrylcholinesterase.
19685167 2010 Butyrylcholinesterase K variant and the APOE-epsilon 4 allele work in synergy to increase the risk of coronary artery disease especially in diabetic patients.
19617863 2009 Progression from mild cognitive impairment to Alzheimer's disease: effects of sex, butyrylcholinesterase genotype, and rivastigmine treatment.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19542320 2009 Adenovirus-transduced human butyrylcholinesterase in mouse blood functions as a bioscavenger of chemical warfare nerve agents.
19481150 2009 No differences of butyrylcholinesterase protein activity and allele frequency in Lewy body diseases.
19474452 2009 Perioperative genomic profiles using structure-specific oligonucleotide probes.
19452557 2009 The structure of G117H mutant of butyrylcholinesterase: nerve agents scavenger.
19383604 2009 The butyrylcholinesterase K variant confers structurally derived risks for Alzheimer pathology.
19368529 2009 Structure-activity analysis of aging and reactivation of human butyrylcholinesterase inhibited by analogues of tabun.
19217865 2009 Direct correlation between molecular dynamics and enzymatic stability: a comparative neutron scattering study of native human butyrylcholinesterase and its "aged" soman conjugate.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19019080 2009 Respective roles of the catalytic domains and C-terminal tail peptides in the oligomerization and secretory trafficking of human acetylcholinesterase and butyrylcholinesterase.
19010318 2009 Butyrylcholinesterase activity and mortality risk in hemodialysis patients: comparison to hsCRP and albumin.
19006190 2009 BuChE-K and APOE epsilon4 allele frequencies in Lewy body dementias, and influence of genotype and hyperhomocysteinemia on cognitive decline.
18975951 2008 Aging of cholinesterases phosphylated by tabun proceeds through O-dealkylation.
18780301 2009 Variability of AChE, BChE, and ChAT genes in the late-onset form of Alzheimer's disease and relationships with response to treatment with Donepezil and Rivastigmine.
18778798 2008 Mechanism of hydrolysis of dicholine esters with long polymethylene chain by human butyrylcholinesterase.
18640242 2008 Butyrylcholinesterase K variant associated with higher enzyme activity in the temporal cortex of elderly patients.
18555211 2008 Two new mutations of the human BCHE gene (IVS3-14T>C and L574fsX576).
18550040 2008 Association of variants of the -116 site of the butyrylcholinesterase BCHE gene to enzyme activity and body mass index.
18457821 2008 Rational design of a drug for Alzheimer's disease with cholinesterase inhibitory and neuroprotective activity.
18422653 2008 Kinetic analysis of effector modulation of butyrylcholinesterase-catalysed hydrolysis of acetanilides and homologous esters.
18334913 2008 Synergistic effect of apolipoprotein E epsilon4 and butyrylcholinesterase K-variant on progression from mild cognitive impairment to Alzheimer's disease.
18322399 2008 Human recombinant butyrylcholinesterase purified from the milk of transgenic goats interacts with beta-amyloid fibrils and suppresses their formation in vitro.
18300943 2008 Five new naturally occurring mutations of the BCHE gene and frequencies of 12 butyrylcholinesterase alleles in a Brazilian population.
18290843 2008 Gene-gene interaction between 14-3-3 zeta and butyrylcholinesterase modulates Alzheimer's disease risk.
18237553 2008 Butyrylcholinesterase activity is reduced in haemodialysis patients: is there association with hyperhomocysteinemia and/or oxidative stress?
18203274 2008 Glycoproteomic characterization of butyrylcholinesterase from human plasma.
18165570 2008 Rapid and accurate detection of atypical and Kalow variants in the butyrylcholinesterase gene using denaturing high performance liquid chromatography.
18076380 2008 Lamellipodin proline rich peptides associated with native plasma butyrylcholinesterase tetramers.
18075469 2007 Two novel mutations in the BCHE gene in patients with prolonged duration of action of mivacurium or succinylcholine during anaesthesia.
17996334 2009 Influence of genetic polymorphisms in the apolipoprotein (APOE) and the butyrylcholinesterase (BCHE) gene on stress markers in older adults: a 3-year study.
17923322 2007 Butyrylcholinesterase, ApoE and Alzheimer's disease in a population from the Canary Islands (Spain).
17917325 2007 Serum butyrylcholinesterase is strongly associated with adiposity, the serum lipid profile and insulin resistance.
17852836 2008 Butyrylcholinesterase K variants increase the risk of coronary artery disease in the population of western Iran.
17768338 2007 Crystallization and X-ray structure of full-length recombinant human butyrylcholinesterase.
17701416 2007 Homozygosity for the K variant of BCHE gene increases the risk for development of neurofibrillary pathology but not amyloid deposits at young ages.
17700357 2007 Expression of three naturally occurring genetic variants (G75R, E90D, I99M) of the BCHE gene of human butyrylcholinesterase.
17698511 2007 Aging pathways for organophosphate-inhibited human butyrylcholinesterase, including novel pathways for isomalathion, resolved by mass spectrometry.
17690023 2007 Kinetic analysis of butyrylcholinesterase-catalyzed hydrolysis of acetanilides.
17660298 2007 Recombinant human butyrylcholinesterase from milk of transgenic animals to protect against organophosphate poisoning.
17503475 2007 Alzheimer's disease: case-control association study of polymorphisms in ACHE, CHAT, and BCHE genes in a Sardinian sample.
17410321 2007 Interaction between estrogen receptor-alpha and butyrylcholinesterase genes modulates Alzheimer's disease risk.
17355286 2007 Mechanisms of cholinesterase inhibition by inorganic mercury.
17350607 2007 Determination of butyrylcholinesterase (BChE) phenotypes to predict the risk of prolonged apnea in persons receiving succinylcholine in the healthy population of western Iran.
17335779 2007 Calcium-activated butyrylcholinesterase in human skin protects acetylcholinesterase against suicide inhibition by neurotoxic organophosphates.
17318303 2007 Comparison of cognitive functions between people with silent and wild-type butyrylcholinesterase.
17275003 2007 Genetic risk for restenosis after coronary stenting.
17192624 2006 Acetyl- and butyrylcholinesterase activities decrease in human colon adenocarcinoma.
17116317 2007 Susceptibility groups for Alzheimer's disease (OPTIMA cohort): integration of gene variants and biochemical factors.
16973370 2006 Differential CSF butyrylcholinesterase levels in Alzheimer's disease patients with the ApoE epsilon4 allele, in relation to cognitive function and cerebral glucose metabolism.
16962996 2006 Butyrylcholinesterase is present in the human epidermis and is regulated by H2O2: more evidence for oxidative stress in vitiligo.
16909200 2006 Cholinesterases are down-expressed in human colorectal carcinoma.
16824336 2006 [Activity of esterases and effect of genetic polymorphism in workers exposed to organophosphorus pesticides].
16801396 2006 Comparison of polyethylene glycol-conjugated recombinant human acetylcholinesterase and serum human butyrylcholinesterase as bioscavengers of organophosphate compounds.
16788378 2006 Naturally occurring mutation Leu307Pro of human butyrylcholinesterase in the Vysya community of India.
16731619 2006 Butyrylcholinesterase attenuates amyloid fibril formation in vitro.
16504521 2006 On the active site for hydrolysis of aryl amides and choline esters by human cholinesterases.
16429499 2005 Variant K of butyrylcholinesterase and types 1 and 2 of diabetes mellitus.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16298355 2006 Improved prediction of early-onset coronary artery disease using APOE epsilon4, BChE-K, PPARgamma2 Pro12 and ENOS T-786C in a polygenic model.
16289064 2005 Protection against soman or VX poisoning by human butyrylcholinesterase in guinea pigs and cynomolgus monkeys.
16288482 2006 Modeling evolution of hydrogen bonding and stabilization of transition states in the process of cocaine hydrolysis catalyzed by human butyrylcholinesterase.
16278840 2006 In vivo butyrylcholinesterase activity is not increased in Alzheimer's disease synapses.
16213467 2005 Butyrylcholinesterase, paraoxonase, and albumin esterase, but not carboxylesterase, are present in human plasma.
16105444 2005 [Relationship between the polymorphism of carboxylic esterases and genetic susceptibility to organophosphates pesticides exposure].
16020944 2005 Interaction between CYP19 aromatase and butyrylcholinesterase genes increases Alzheimer's disease risk.
15907830 2005 Relationship between serum butyrylcholinesterase and the metabolic syndrome.
15834019 2005 Rate of progression of cognitive decline in Alzheimer's disease: effect of butyrylcholinesterase K gene variation.
15802910 2005 The k variant of the butyrylcholinesterase gene is associated with reduced phosphorylation of tau in dementia patients.
15781196 2005 Four new mutations in the BCHE gene of human butyrylcholinesterase in a Brazilian blood donor sample.
15731585 2005 Response to mivacurium in patients carrying the k variant in the butyrylcholinesterase gene.
15696543 2005 Molecular dynamics simulations of human butyrylcholinesterase.
15690550 2005 Candidate gene association studies of genes involved in neuronal cholinergic transmission in Alzheimer's disease suggests choline acetyltransferase as a candidate deserving further study.
15667209 2005 Role of water in aging of human butyrylcholinesterase inhibited by echothiophate: the crystal structure suggests two alternative mechanisms of aging.
15563885 2005 Novel mutations in the BCHE gene in patients with no butyrylcholinesterase activity.
15519745 2004 Analysis of association between butyrylcholinesterase K variant and apolipoprotein E genotypes in Alzheimer's disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15465921 2005 Gene transfer of cocaine hydrolase suppresses cardiovascular responses to cocaine in rats.
15449725 2004 Interaction of human butyrylcholinesterase variants with bambuterol and terbutaline.
15386241 2005 Possible influence of BCHE locus of butyrylcholinesterase on stature and body mass index.
15258737 2004 Large-scale studies of the functional K variant of the butyrylcholinesterase gene in relation to Type 2 diabetes and insulin secretion.
15111428 2004 The influence of solvent composition on global dynamics of human butyrylcholinesterase powders: a neutron-scattering study.
15060281 2004 Acetylcholinesterase/paraoxonase genotype and expression predict anxiety scores in Health, Risk Factors, Exercise Training, and Genetics study.
15028279 2004 PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14735258 2004 Frequency and enzyme activity of the butyrylcholinesterase K-variant in a Turkish population.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14686935 2004 Damped oscillatory hysteretic behaviour of butyrylcholinesterase with benzoylcholine as substrate.
14622273 2003 Aromatic amino-acid residues at the active and peripheral anionic sites control the binding of E2020 (Aricept) to cholinesterases.
12901493 2001 Association between low-density lipoprotein receptor-related protein gene, butyrylcholinesterase gene and Alzheimer' s disease in Chinese.
12881446 2003 Butyrylcholinesterase (BCHE) genotyping for post-succinylcholine apnea in an Australian population.
12869558 2003 Crystal structure of human butyrylcholinesterase and of its complexes with substrate and products.
12811800 2003 Differential distribution of butyrylcholinesterase and acetylcholinesterase in the human thalamus.
12724618 2003 Frequency of butyrylcholinesterase gene mutations in individuals with abnormal inhibition numbers: an Italian-population study.
12687586 2003 Genetic variants of serum butyrylcholinesterase in Chilean Mapuche Indians.
12668920 2003 Regulation of attention and response to therapy in dementia by butyrylcholinesterase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417112 2002 Novel mutation and multiple mutations found in the human butyrylcholinesterase gene.
12387584 2002 Rapid simultaneous genotyping of the frequent butyrylcholinesterase variants Asp70Gly and Ala539Thr with fluorescent hybridization probes.
12130740 2002 Wild-type and A328W mutant human butyrylcholinesterase tetramers expressed in Chinese hamster ovary cells have a 16-hour half-life in the circulation and protect mice from cocaine toxicity.
12074828 2002 Relation between butyrylcholinesterase K variant, paraoxonase 1 (PON1) Q and R and apolipoprotein E epsilon 4 genes in early-onset coronary artery disease.
12009429 2002 Antidepressants inhibit human acetylcholinesterase and butyrylcholinesterase activity.
12003252 2001 Butyrylcholinesterase and cognitive function.
11928765 2002 Naturally occurring mutation, Asp70his, in human butyrylcholinesterase.
11849755 2002 Age-dependent association between butyrylcholinesterase K-variant and Alzheimer disease-related neuropathology in human brains.
11793025 2001 Butyrylcholinesterase K variant on chromosome 3 q is associated with Type II diabetes in white Caucasian subjects.
11738493 2001 Using meta-analysis to explain the diversity of results in genetic studies of late-onset Alzheimer's disease and to identify high-risk subgroups.
11725818 2001 Neither the butyrylcholinesterase K variant nor transferrin C2 variant confers a risk for Alzheimer's disease in Koreans.
11569538 2001 Butyrylcholinesterase-Mediated enhancement of the enzymatic activity of trypsin.
11436125 2001 Lack of replication of association findings in complex disease: an analysis of 15 polymorphisms in prior candidate genes for sporadic Alzheimer's disease.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11125748 2000 The butyrylcholinesterase K variant is a protective factor for sporadic Alzheimer's disease in women.
10529218 1999 Conserved aromatic residues of the C-terminus of human butyrylcholinesterase mediate the association of tetramers.
10404729 1999 Three point mutations of human butyrylcholinesterase in a Japanese family and the alterations of three-dimensional structure.
9694584 1998 Identification of a point mutation associated with a silent phenotype of human serum butyrylcholinesterase--a case of familial cholinesterasemia.
9673783 1998 The influence of plasma butyrylcholinesterase concentration on the in vitro hydrolysis of cocaine in human plasma.
9543549 1997 Genetic analysis of a Japanese patient with butyrylcholinesterase deficiency.
9388484 1997 Human butyrylcholinesterase L330I mutation belongs to a fluoride-resistant gene, by expression in human fetal kidney cells.
9191541 1997 Genetic mutations of butyrylcholine esterase identified from phenotypic abnormalities in Japan.
9110359 1997 Characterization of an unstable variant (BChE115D) of human butyrylcholinesterase.
8680411 1995 Mutations of human butyrylcholinesterase gene in a family with hypocholinesterasemia.
8622553 1996 Cocaine and butyrylcholinesterase (BChE): determination of enzymatic parameters.
8554068 1996 Characterization of 12 silent alleles of the human butyrylcholinesterase (BCHE) gene.
8063698 1994 Promoter and transcription start site of human and rabbit butyrylcholinesterase genes.
7634491 1995 Genetic basis of the silent phenotype of serum butyrylcholinesterase in three compound heterozygotes.
3542989 1987 Complete amino acid sequence of human serum cholinesterase.
3477799 1987 Brain cDNA clone for human cholinesterase.
3115973 1987 Location of disulfide bonds within the sequence of human serum cholinesterase.
3067729 1988 Structure of human serum cholinesterase.
3035536 1987 Isolation and characterization of full-length cDNA clones coding for cholinesterase from fetal human tissues.
2915989 1989 Identification of the structural mutation responsible for the dibucaine-resistant (atypical) variant form of human serum cholinesterase.
2758686 1989 Linkage between serum cholinesterase 2 (CHE2) and gamma-crystallin gene cluster (CRYG): assignment to chromosome 2.
2339692 1990 Identification of a frameshift mutation responsible for the silent phenotype of human serum cholinesterase, Gly 117 (GGT----GGAG).
2322535 1990 Structure of the gene for human butyrylcholinesterase. Evidence for a single copy.
2318303 1990 Evidence for a single butyrylcholinesterase gene in individuals carrying the C5 plasma cholinesterase variant (CHE2).
1769658 1991 Refinement of the localization of human butyrylcholinesterase to chromosome 3q26.1-q26.2 using a PCR-derived probe.
1769657 1991 The cloned butyrylcholinesterase (BCHE) gene maps to a single chromosome site, 3q26.
1611188 1992 A variant serum cholinesterase and a confirmed point mutation at Gly-365 to Arg found in a patient with liver cirrhosis.
1415224 1992 Identification of two different point mutations associated with the fluoride-resistant phenotype for human butyrylcholinesterase.
1349196 1992 DNA mutations associated with the human butyrylcholinesterase J-variant.
1306123 1992 Structural basis of the butyrylcholinesterase H-variant segregating in two Danish families.