Property Summary

Ligand Count 819
NCBI Gene PubMed Count 219
PubMed Score 2272.45
PubTator Score 1889.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (29)

Disease log2 FC p
glioblastoma 2.100 4.1e-06
adult high grade glioma 2.100 5.1e-04
astrocytic glioma 2.500 2.0e-02
Astrocytoma, Pilocytic 3.000 8.3e-10
Atopic dermatitis -1.500 1.3e-04
breast carcinoma -1.300 7.4e-04
colon cancer -3.300 5.5e-07
cutaneous lupus erythematosus -2.600 1.9e-03
cystic fibrosis 2.193 2.6e-06
ependymoma -1.500 1.3e-02
fibroadenoma -1.600 1.1e-02
group 3 medulloblastoma -2.500 1.3e-03
Hydrolethalus syndrome -2.760 1.5e-02
interstitial cystitis -1.600 1.4e-02
intraductal papillary-mucinous adenoma (... -2.900 4.4e-04
intraductal papillary-mucinous carcinoma... -3.100 3.9e-04
intraductal papillary-mucinous neoplasm ... -3.100 5.2e-03
invasive ductal carcinoma -2.200 7.0e-03
lung adenocarcinoma -1.800 5.1e-15
lung cancer 3.200 1.5e-05
lung carcinoma -1.800 1.4e-08
malignant mesothelioma -7.600 2.3e-10
medulloblastoma, large-cell -2.300 2.5e-03
non-small cell lung cancer -1.739 1.6e-07
oligodendroglioma 2.600 1.8e-02
ovarian cancer -8.300 4.3e-30
Pick disease -1.200 8.2e-03
progressive supranuclear palsy -1.100 3.7e-02
psoriasis -1.500 7.8e-05

 OMIM Phenotype (1)

 CSPA Cell Line (2)

PDB (46)

Gene RIF (210)

AA Sequence

MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLR      1 - 70
FKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIW     71 - 140
IYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQLALQWVQKNI    141 - 210
AAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGC    211 - 280
SRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVN    281 - 350
KDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDV    351 - 420
VGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDNYTKAEEI    421 - 490
LSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKVLEM    491 - 560
TGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL                                561 - 602
//

Text Mined References (246)

PMID Year Title