1. Home
  2. Targets
  3. nucleic acid binding
  4. RNA binding protein
  5. mRNA processing factor
  6. mRNA splicing factor
  7. Pre-mRNA-splicing factor SPF27

Tbio Pre-mRNA-splicing factor SPF27

Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR).

 Comments

Property Summary

NCBI Gene PubMed Count 22
PubMed Score 14.21
PubTator Score 27.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Multiple myeloma 1327 1.8e-03
oligodendroglioma 2849 3.9e-02

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.243 1.8e-03
oligodendroglioma -1.400 3.9e-02

Synonym

Accession O75934 Q6FGS0
Symbols DAM1
SPF27
Snt309

Gene

BCAS2

PANTHER Protein Class (4)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (11)

See all...

 GO Component (9)

 GO Process (3)

 Compartment GO Term (40)

See all...

 HCA RNA Cell Line (56)

See all...

Pathway (6)

Protein-protein Interaction (36)

U2SURP   SART1   PQBP1   WBP4   SYF2   CSTF3   USP39   PRPF8   FIP1L1   CWC27   DDX46   DDX42   CHERP   SUGP1   CCAR1   SRRM1   PRPF38A   U2AF1L4   SNRNP27   PRPF31   MAGOHB   PPWD1   SNRNP40   CDC5L   HNRNPUL1   UPF3B   CSTF2T   CWC22   RBM22   CWC25   CWC15   PUF60   ISY1   PRPF19   SRRM2   WBP11  

Gene RIF (7)

PMID Text
26560693 These results demonstrate that Aurora B inhibits both direct interaction with the microtubule and oligomerization of the Dam1 complex to drive error correction during mitosis.
26319152 BCAS2 interacts with HSF4 and negatively regulates its protein stability via ubiquitination.
25461807 BCAS2 is a novel androgen receptor-interacting protein.
24667650 ERRbeta signalling leads to BCAS2-mediated blockage of the G1/S transition and inhibition of the epithelial to mesenchymal transition through FST-mediated regulation of E-cadherin
19903847 BCAS2 directly interacts with p53 to reduce p53 transcriptional activity by mildly but consistently decreasing p53 protein in the absence of DNA damage. In the presence of DNA damage, BCAS2 prominently reduces p53 protein.
15694360 This study suggested that BCAS2 might play an important role in breast cancer development by increasing the estrogen receptor's function.
12169396 The BCAS2 gene was amplified in two of 60 primary breast cancer tissues, but not in other cancer cells, providing the first evidence of amplification within this region and indicating that BCAS2 gene codes for a nuclear protein.

AA Sequence 

MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEF      1 - 70
ERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNE     71 - 140
NLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIK    141 - 210
QQHGEANKENIRQDF                                                           211 - 225
//

Text Mined References (27)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26560693 2015 The molecular architecture of the Dam1 kinetochore complex is defined by cross-linking based structural modelling.
26319152 2015 BCAS2 interacts with HSF4 and negatively regulates its protein stability via ubiquitination.
25461807 2015 BCAS2 promotes prostate cancer cells proliferation by enhancing AR mRNA transcription and protein stability.
25416956 2014 A proteome-scale map of the human interactome network.
24667650 2014 ERR? signalling through FST and BCAS2 inhibits cellular proliferation in breast cancer cells.
24332808 2014 PRP19 transforms into a sensor of RPA-ssDNA after DNA damage and drives ATR activation via a ubiquitin-mediated circuitry.
24189344 2014 Common genetic variants on 1p13.2 associate with risk of autism.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21269460 2011 Initial characterization of the human central proteome.
20176811 2010 Molecular architecture of the human Prp19/CDC5L complex.
19903847 2009 Breast cancer amplified sequence 2, a novel negative regulator of the p53 tumor suppressor.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15694360 2005 Potentiation of estrogen receptor transcriptional activity by breast cancer amplified sequence 2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
12406557 2002 Mouse DAM1 regulates pro-apoptotic activity of BLK in mammary epithelial cells.
12169396 2002 Amplification of the BCAS2 gene at chromosome 1p13.3-21 in human primary breast cancer.
10403562 1999 Identification of a novel gene, DAM1, amplified at chromosome 1p13.3-21 region in human breast cancer cell lines.
9731529 1998 Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.