Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.60
PubTator Score 6.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
ependymoma -2.700 2.2e-02
glioblastoma -1.400 7.5e-03
medulloblastoma -2.400 7.4e-09
atypical teratoid/rhabdoid tumor -2.500 2.1e-07
medulloblastoma, large-cell -2.400 3.5e-04
primitive neuroectodermal tumor -2.000 7.5e-04
intraductal papillary-mucinous adenoma (... 4.500 5.3e-05
intraductal papillary-mucinous carcinoma... 4.300 1.6e-04
intraductal papillary-mucinous neoplasm ... 3.600 3.2e-03
colon cancer -3.400 6.4e-05
pancreatic cancer 1.800 6.9e-06
interstitial cystitis -2.800 5.7e-05
pediatric high grade glioma -1.400 7.7e-03
pilocytic astrocytoma 1.700 2.0e-03
subependymal giant cell astrocytoma -3.269 1.1e-02
nasopharyngeal carcinoma -1.700 1.1e-09
ovarian cancer -1.300 3.4e-07
psoriasis -1.400 8.3e-33

Synonym

Accession O75363 A0AVG5 Q68CZ3
Symbols AIBC1
NABC1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18976975 Knockdown of breast carcinoma amplified sequence 1 (BCAS1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
15583422 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGNQMSVPQRVEDQENEPEAETYQDNASALNGVPVVVSTHTVQHLEEVDLGISVKTDNVATSSPETTEIS      1 - 70
AVADANGKNLGKEAKPEAPAAKSRFFLMLSRPVPGRTGDQAADSSLGSVKLDVSSNKAPANKDPSESWTL     71 - 140
PVAAGPGQDTDKTPGHAPAQDKVLSAARDPTLLPPETGGAGGEAPSKPKDSSFFDKFFKLDKGQEKVPGD    141 - 210
SQQEAKRAEHQDKVDEVPGLSGQSDDVPAGKDIVDGKEKEGQELGTADCSVPGDPEGLETAKDDSQAAAI    211 - 280
AENNNSIMSFFKTLVSPNKAETKKDPEDTGAEKSPTTSADLKSDKANFTSQETQGAGKNSKGCNPSGHTQ    281 - 350
SVTTPEPAKEGTKEKSGPTSLPLGKLFWKKSVKEDSVPTGAEENVVCESPVEIIKSKEVESALQTVDLNE    351 - 420
GDAAPEPTEAKLKREESKPRTSLMAFLRQMSVKGDGGITHSEEINGKDSSCQTSDSTEKTITPPEPEPTG    421 - 490
APQKGKEGSSKDKKSAAEMNKQKSNKQEAKEPAQCTEQATVDTNSLQNGDKLQKRPEKRQQSLGGFFKGL    491 - 560
GPKRMLDAQVQTDPVSIGPVGKSK                                                  561 - 584
//

Text Mined References (15)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15583422 2004 Analysis of candidate genes for prostate cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14567997 2003 Characterization of the novel amplified in breast cancer-1 (NABC1) gene product.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11148209 2001 The 8-kDa dynein light chain binds to its targets via a conserved (K/R)XTQT motif.
10857754 2000 NABC1 (BCAS1): alternative splicing and downregulation in colorectal tumors.
9671742 1998 Positional cloning of ZNF217 and NABC1: genes amplified at 20q13.2 and overexpressed in breast carcinoma.
8758909 1996 Independent amplification and frequent co-amplification of three nonsyntenic regions on the long arm of chromosome 20 in human breast cancer.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.