Property Summary

NCBI Gene PubMed Count 159
PubMed Score 220.61
PubTator Score 431.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Neoplasm Invasiveness 151 0.0 0.0
Pancreatic Neoplasms 82 0.0 0.0
Disease Target Count
Pancreatic Neoplasm 82
Disease Target Count P-value
osteosarcoma 7766 2.9e-06
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2388 4.355 2.2

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.933 2.9e-06

Protein-protein Interaction (1)

Gene RIF (82)

AA Sequence

MNHLNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKK      1 - 70
PAGPGPGPPATPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTPSKAQQGLYQVPGPSPQFQSP     71 - 140
PAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPA    141 - 210
KVVVPTRVGQGYVYEAAQPEQDEYDIPRHLLAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGR    211 - 280
DPLLEVYDVPPSVEKGLPPSNHHAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAA    281 - 350
PPPDSPPAEDVYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGGVVDSGVYAVPPPAEREA    351 - 420
PAEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDLAGSAGATGSW    421 - 490
RSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAKLSRQLQKMEDVHQTLVAHGQ    491 - 560
ALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATAPGPEGGGTLHPNPTDKTS    561 - 630
SIQSRPLPSPPKFTSQDSPDGQYENSEGGWMEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQ    631 - 700
LKQFERLEQEVSRPIDHDLANWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVA    701 - 770
TNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSP    771 - 840
SAAQDMVERVKELGHSTQQFRRVLGQLAAA                                            841 - 870
//

Text Mined References (169)

PMID Year Title