Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.41
PubTator Score 6.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
ependymoma -1.700 1.6e-02
psoriasis -2.700 5.2e-05
osteosarcoma -1.626 3.5e-06
atypical teratoid / rhabdoid tumor -2.000 7.0e-08
glioblastoma 1.500 2.1e-03
medulloblastoma -1.400 8.3e-06
medulloblastoma, large-cell -2.200 2.9e-07
primitive neuroectodermal tumor -1.300 1.9e-02
pancreatic ductal adenocarcinoma liver m... -1.008 1.4e-02
adult high grade glioma 1.500 9.6e-03
pilocytic astrocytoma -1.100 2.5e-05
Pick disease -1.400 1.2e-04
progressive supranuclear palsy -1.100 3.7e-02
gastric carcinoma -1.500 6.9e-03
ovarian cancer 2.100 2.8e-10

Gene RIF (4)

PMID Text
21068099 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
18097552 Bap29varP acts as an essential chaperone, influencing the processing and trafficking of Pgp to the cell surface.

AA Sequence

MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREV      1 - 70
RKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQ     71 - 140
AENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKM    141 - 210
QSERLSKEYDQLLKEHSELQDRLERGNKKRL                                           211 - 241
//

Text Mined References (21)

PMID Year Title
25327138 2014 A disulfide polymerized protein crystal.
21378988 2011 A genome-wide association study in Europeans and South Asians identifies five new loci for coronary artery disease.
21269460 2011 Initial characterization of the human central proteome.
21068099 2011 Meta-analysis of genome-wide association studies confirms a susceptibility locus for knee osteoarthritis on chromosome 7q22.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19946888 2010 Defining the membrane proteome of NK cells.
18097552 2008 Bap29varP, a variant of Bap29, influences the cell surface expression of the human P-glycoprotein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12886015 2003 A high-molecular-weight complex of membrane proteins BAP29/BAP31 is involved in the retention of membrane-bound IgD in the endoplasmic reticulum.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8070407 1994 Two new proteins preferentially associated with membrane immunoglobulin D.