Property Summary

NCBI Gene PubMed Count 22
PubMed Score 94.34
PubTator Score 22.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 3.100 3.2e-03
ependymoma 2.200 3.4e-02
oligodendroglioma 3.400 1.0e-03
cutaneous lupus erythematosus -1.100 9.2e-04
psoriasis 1.300 1.9e-04
glioblastoma 1.600 4.7e-03
osteosarcoma 1.490 1.1e-06
group 3 medulloblastoma -3.100 4.1e-08
atypical teratoid / rhabdoid tumor -2.300 2.2e-07
medulloblastoma, large-cell -2.400 2.1e-06
adult high grade glioma 1.600 2.3e-04
pilocytic astrocytoma 1.900 1.8e-06
subependymal giant cell astrocytoma -1.873 1.3e-02
ovarian cancer -1.100 2.3e-06

 MGI Phenotype (1)

 CSPA Cell Line (2)

Gene RIF (8)

PMID Text
22930747 Data indicate that median methylation levels of BCAN, HOXD1, KCTD8, KLF11, NXPH1, POU4F1, SIM1, and TCF7L1 were >/=30% higher than in normal samples, representing potential biomarkers for tumor diagnosis.
21997179 High Brevican is associated with the invasive phenotype of low-grade astrocytoma.
20950796 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19910543 Observational study of gene-disease association. (HuGE Navigator)
18611854 The proteoglycan brevican binds to fibronectin after proteolytic cleavage and promotes glioma cell motility
16133547 These results demonstrate for the first time that ADAMTS-5 is capable of degrading brevican and is overexpressed in glioblastoma cells, and suggest that ADAMTS-5 may play a role in glioma cell invasion through the cleavage of brevican.
16061654 Authors describe the expression of BEHAB/brevican in human brain and characterize two novel glioma-specific isoforms which are generated by differential glycosylation and are absent from normal adult brain and other neuropathologies.
11873941 gene locus at chromosome 1q21-23.

AA Sequence

MAQLFLPLLAALVLAQAPAALADVLEGDSSEDRAFRVRIAGDAPLQGVLGGALTIPCHVHYLRPPPSRRA      1 - 70
VLGSPRVKWTFLSRGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDVSLALSELRPNDSGIYRCEVQ     71 - 140
HGIDDSSDAVEVKVKGVVFLYREGSARYAFSFSGAQEACARIGAHIATPEQLYAAYLGGYEQCDAGWLSD    141 - 210
QTVRYPIQTPREACYGDMDGFPGVRNYGVVDPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQER    211 - 280
GAEIATTGQLYAAWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNV    281 - 350
YCFRDSAQPSAIPEASNPASNPASDGLEAIVTVTETLEELQLPQEATESESRGAIYSIPIMEDGGGGSST    351 - 420
PEDPAEAPRTLLEFETQSMVPPTGFSEEEGKALEEEEKYEDEEEKEEEEEEEEVEDEALWAWPSELSSPG    421 - 490
PEASLPTEPAAQEESLSQAPARAVLQPGASPLPDGESEASRPPRVHGPPTETLPTPRERNLASPSPSTLV    491 - 560
EAREVGEATGGPELSGVPRGESEETGSSEGAPSLLPATRAPEGTRELEAPSEDNSGRTAPAGTSVQAQPV    561 - 630
LPTDSASRGGVAVVPASGDCVPSPCHNGGTCLEEEEGVRCLCLPGYGGDLCDVGLRFCNPGWDAFQGACY    631 - 700
KHFSTRRSWEEAETQCRMYGAHLASISTPEEQDFINNRYREYQWIGLNDRTIEGDFLWSDGVPLLYENWN    701 - 770
PGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVDTVL    771 - 840
RYRCREGLAQRNLPLIRCQENGRWEAPQISCVPRRPARALHPEEDPEGRQGRLLGRWKALLIPPSSPMPG    841 - 910
P//

Text Mined References (24)

PMID Year Title
22930747 2012 Genome-wide methylation screen in low-grade breast cancer identifies novel epigenetically altered genes as potential biomarkers for tumor diagnosis.
21997179 2012 Brevican, neurocan, tenascin-C and versican are mainly responsible for the invasiveness of low-grade astrocytoma.
20950796 2011 Candidate gene analysis of the human natural killer-1 carbohydrate pathway and perineuronal nets in schizophrenia: B3GAT2 is associated with disease risk and cortical surface area.
19910543 2010 Confirmation of genomewide association signals in Chinese Han population reveals risk loci for ischemic stroke.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
18611854 2008 The proteoglycan brevican binds to fibronectin after proteolytic cleavage and promotes glioma cell motility.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16133547 2005 Human glioblastomas overexpress ADAMTS-5 that degrades brevican.
16061654 2005 Novel tumor-specific isoforms of BEHAB/brevican identified in human malignant gliomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14741698 2004 Secreted brevican mRNA is expressed in the adult rat pituitary.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14550776 2003 Molecular cloning of Bral2, a novel brain-specific link protein, and immunohistochemical colocalization with brevican in perineuronal nets.
14522884 2003 A peptide with three hyaluronan binding motifs inhibits tumor growth and induces apoptosis.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11873941 2002 Human BRAL1 and BCAN genes that belong to the link-module superfamily are tandemly arranged on chromosome 1q21-23.
11054543 2000 cDNA cloning, chromosomal localization, and expression analysis of human BEHAB/brevican, a brain specific proteoglycan regulated during cortical development and in glioma.
11038354 2001 The proteoglycans aggrecan and Versican form networks with fibulin-2 through their lectin domain binding.
10986281 2000 Brevican is degraded by matrix metalloproteinases and aggrecanase-1 (ADAMTS4) at different sites.
9294172 1997 The C-type lectin domains of lecticans, a family of aggregating chondroitin sulfate proteoglycans, bind tenascin-R by protein-protein interactions independent of carbohydrate moiety.
7592978 1995 Brevican, a chondroitin sulfate proteoglycan of rat brain, occurs as secreted and cell surface glycosylphosphatidylinositol-anchored isoforms.