Property Summary

NCBI Gene PubMed Count 62
PubMed Score 221.51
PubTator Score 130.93

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.200 7.5e-05
psoriasis -1.300 5.8e-04
lung carcinoma 2.200 1.5e-26

Protein-protein Interaction (10)

Gene RIF (30)

PMID Text
26137540 Cytometry analysis evidenced a specific expression profile on reticulocytes of SCA infants, with notably an increased expression of the adhesion molecules Lu/BCAM, ICAM-4 and LFA-3, both in percentage of positive cells and in surface density.
25809027 The variable levels of expression of mutated JAK2 and BCAM proteins determine different adhesion patterns of erythrocytes from polycythemia vera patients.
25582271 Through molecular genotyping we also identified polymorphisms in RhCE, Kell, Duffy, Colton, Lutheran and Scianna loci in donors and patients.
25051049 High BCAM expression is associated with hepatocellular carcinoma.
24616094 Adhesion of sickle reticulocytes to HC-treated endothelial cells was decreased despite the HC-derived increase of Lu/BCAM expression.
24453976 These studies revealed amino acids 720 to 1014 of CNF1 as the binding site for Lu/BCAM.
24036115 tumor cell migration on LM-511 requires that Lu/B-CAM competitively modulates cell attachment through integrins.
23421542 Glu425 in the Lu glycoprotein is required for expression of Lu7, and Ala425 is associated with the LU:-7 phenotype. This completes the molecular basis associated with all antigens known to be in the Lutheran blood group system.
23168236 DARC and BCAM expression was associated with pathogenesis of thyroid carcinoma and correlated with clinical-pathological features.
22404936 Increases in adhesion frequency provide significant evidence of the role of epinephrine in BCAM/Lu-laminin and ICAM-4-alpha(v)beta(3) bonding, and suggest mechanisms of vaso-occlusion during physical exertion in sickle cell trait.
21858073 Data indicate that the function-blocking antibody against Lu/B-CAM should be useful for not only investigating cell adhesion to laminin alpha5 but also for developing drugs to inhibit sickle cell vaso-occlusion.
20655789 BCAM glycoproteins are the unique erythroid receptors of laminin alpha5 chain, a major component of the extracellular matrix and are involved in several erythrocyte diseases.
20562314 Aggregation of mononuclear and red blood cells through an {alpha}4{beta}1-Lu/basal cell adhesion molecule interaction in sickle cell disease
20370913 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19667067 Lutheran blood group glycoprotein (Lu) is one of the proteins cleaved by MT1-MMP.
19201739 Observational study of genotype prevalence. (HuGE Navigator)
19065527 Observational study of genotype prevalence. (HuGE Navigator)
18972067 CD239 was expressed in a constitutive fashion in polycythaemia vera-derived bone marrow cells and thus a pro-thrombotic function does not seem to be mediated by increased CD239 expression alone.
18815288 the interaction of the Lu cytoplasmic tail with the cytoskeleton regulates its adhesive receptor function
18635166 These results suggest that laminins containing alpha 5 serve as functional substrates regulating progression of hepatocellular carcinoma.
18514010 Lu/BCAM gps expressed on erythroid or on endothelial cells are involved in SS RBC-endothelium interactions & could play a role in abnormal adhesion of SS RBCs to vascular endothelium contributing to vaso-occlusive crises reported for sickle cell disease.
18510579 Observational study of genetic testing. (HuGE Navigator)
18302987 study presents a combined modeling & small angle X-ray scattering approach that extends the structural analysis of Lu gp to all five extracellular domains & provides further insight to its interaction with laminins (Ln511 & Ln521)
18067501 Observational study of genetic testing. (HuGE Navigator)
17638854 The Laminin 511/521-binding site on the Lutheran blood group glycoprotein is located at the flexible junction of Ig domains 2 and 3.
16584446 B-CAM spliceoform seems to be overexpressed by a variety of different malignant tumors and may be involved, along with other adhesion receptor proteins, in malignant transformation and tumor metastasis. (review)
16236823 Lu mediates the adhesion of human endothelial cells to alpha5 laminins in collaboration with integrins beta(1) and alpha(v)beta(3).
15278364 interactions of B-CAM and laminin may be involved in progression of epithelial skin tumors
14755370 B-CAM/LU is the most critical receptor mediating adhesion to laminin under both static and flow conditions in sickle cell anemia.
12244066 Results demonstrate that the alpha5 LG3 module is essential for the Lutheran blood group glycoprotein (Lu) binding to laminin alpha5.

AA Sequence

MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTD      1 - 70
RSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATAR     71 - 140
LNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVR    141 - 210
EASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGW    211 - 280
VREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQL    281 - 350
SKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNG    351 - 420
TYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGG    421 - 490
SPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGL    491 - 560
LLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC      561 - 628
//

Text Mined References (68)

PMID Year Title
26137540 2015 Erythroid Adhesion Molecules in Sickle Cell Anaemia Infants: Insights Into Early Pathophysiology.
25809027 2015 Lu/BCAM-mediated cell adhesion as biological marker of JAK2V617F activity in erythrocytes of polycythemia vera patients.
25582271 2015 Erythrocyte genotyping for transfusion-dependent patients at the Azienda Universitaria Policlinico of Naples.
25416956 2014 A proteome-scale map of the human interactome network.
25051049 2014 Soluble Lutheran/basal cell adhesion molecule is detectable in plasma of hepatocellular carcinoma patients and modulates cellular interaction with laminin-511 in vitro.
24755620 2014 Overrepresentation of glutamate signaling in Alzheimer's disease: network-based pathway enrichment using meta-analysis of genome-wide association studies.
24616094 2014 Hydroxycarbamide decreases sickle reticulocyte adhesion to resting endothelium by inhibiting endothelial lutheran/basal cell adhesion molecule (Lu/BCAM) through phosphodiesterase 4A activation.
24453976 2014 Lu/BCAM adhesion glycoprotein is a receptor for Escherichia coli Cytotoxic Necrotizing Factor 1 (CNF1).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24036115 2013 The lutheran/basal cell adhesion molecule promotes tumor cell migration by modulating integrin-mediated cell attachment to laminin-511 protein.
23421542 2012 The molecular basis of the LU:7 and LU:-7 phenotypes.
23406016 2013 Combining phenotypic and proteomic approaches to identify membrane targets in a 'triple negative' breast cancer cell type.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
23168236 2013 DARC (Duffy) and BCAM (Lutheran) reduced expression in thyroid cancer.
23160466 2013 JAK2V617F activates Lu/BCAM-mediated red cell adhesion in polycythemia vera through an EpoR-independent Rap1/Akt pathway.
23125034 2013 Molecular analysis of the rare in(Lu) blood type: toward decoding the phenotypic outcome of haploinsufficiency for the transcription factor KLF1.
23001842 2012 A new method for quantitative analysis of cell surface glycoproteome.
22941965 2013 Molecular basis of erythrocyte adhesion to endothelial cells in diseases.
22404936 2012 Epinephrine modulates BCAM/Lu and ICAM-4 expression on the sickle cell trait red blood cell membrane.
21858073 2011 An antibody to the lutheran glycoprotein (Lu) recognizing the LU4 blood type variant inhibits cell adhesion to laminin ?5.
21434869 2011 Novel role for the Lu/BCAM-spectrin interaction in actin cytoskeleton reorganization.
21269460 2011 Initial characterization of the human central proteome.
20655789 2010 Role of Lu/BCAM glycoproteins in red cell diseases.
20566895 2010 Decreased sickle red blood cell adhesion to laminin by hydroxyurea is associated with inhibition of Lu/BCAM protein phosphorylation.
20562314 2010 Aggregation of mononuclear and red blood cells through an {alpha}4{beta}1-Lu/basal cell adhesion molecule interaction in sickle cell disease.
20370913 2010 Genome-wide association analysis of total cholesterol and high-density lipoprotein cholesterol levels using the Framingham heart study data.
19667067 2009 Identification and characterization of Lutheran blood group glycoprotein as a new substrate of membrane-type 1 matrix metalloproteinase 1 (MT1-MMP): a systemic whole cell analysis of MT1-MMP-associating proteins in A431 cells.
19201739 2009 Polymorphic analysis of the Lutheran blood group system in Chinese.
19065527 2008 [Study on the gene polymorphism of Auberger antigens in Chinese population].
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18972067 2009 Expression of adhesion factor CD239 in bone marrow cells in chronic myeloproliferative diseases.
18815288 2008 Adhesive activity of Lu glycoproteins is regulated by interaction with spectrin.
18635166 2008 Laminin alpha 5 mediates ectopic adhesion of hepatocellular carcinoma through integrins and/or Lutheran/basal cell adhesion molecule.
18514010 Role of Lu/BCAM in abnormal adhesion of sickle red blood cells to vascular endothelium.
18510579 2008 Introduction of a real-time-based blood-group genotyping approach.
18302987 Molecular structure of the extracellular region of Lutheran blood group glycoprotein and location of the laminin binding site.
18067501 2008 Blood group genotyping for Jk(a)/Jk(b), Fy(a)/Fy(b), S/s, K/k, Kp(a)/Kp(b), Js(a)/Js(b), Co(a)/Co(b), and Lu(a)/Lu(b) with microarray beads.
17638854 2007 The Laminin 511/521-binding site on the Lutheran blood group glycoprotein is located at the flexible junction of Ig domains 2 and 3.
17319831 2007 Different inactivating mutations in the LU genes of three individuals with the Lutheran-null phenotype.
16584446 2006 The Lutheran glycoprotein: a multifunctional adhesion receptor.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16236823 2006 Laminin-10 and Lutheran blood group glycoproteins in adhesion of human endothelial cells.
15975931 2005 Protein kinase A-dependent phosphorylation of Lutheran/basal cell adhesion molecule glycoprotein regulates cell adhesion to laminin alpha5.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15278364 2004 Molecular interactions of B-CAM (basal-cell adhesion molecule) and laminin in epithelial skin cancer.
15238148 2004 Direct interaction between the Lu/B-CAM adhesion glycoproteins and erythroid spectrin.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14755370 2004 B-CAM/LU expression and the role of B-CAM/LU activation in binding of low- and high-density red cells to laminin in sickle cell disease.
14641871 2003 Molecular bases of the antigens of the Lutheran blood group system.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12493773 2003 Global profiling of the cell surface proteome of cancer cells uncovers an abundance of proteins with chaperone function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12244066 2002 Identification of the binding site for the Lutheran blood group glycoprotein on laminin alpha 5 through expression of chimeric laminin chains in vivo.
11319237 2001 Characterization of the laminin binding domains of the Lutheran blood group glycoprotein.
11133776 2001 Lutheran blood group glycoprotein and its newly characterized mouse homologue specifically bind alpha5 chain-containing human laminin with high affinity.
9642222 1998 The Lutheran blood group glycoproteins, the erythroid receptors for laminin, are adhesion molecules.
9616226 1998 Basal cell adhesion molecule/lutheran protein. The receptor critical for sickle cell adhesion to laminin.
9192786 1997 Organization of the human LU gene and molecular basis of the Lu(a)/Lu(b) blood group polymorphism.
9166867 1997 Use of domain-deletion mutants to locate Lutheran blood group antigens to each of the five immunoglobulin superfamily domains of the Lutheran glycoprotein: elucidation of the molecular basis of the Lu(a)/Lu(b) and the Au(a)/Au(b) polymorphisms.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8781446 1996 A unique gene encodes spliceoforms of the B-cell adhesion molecule cell surface glycoprotein of epithelial cancer and of the Lutheran blood group glycoprotein.
7954395 1994 Molecular cloning of the B-CAM cell surface glycoprotein of epithelial cancers: a novel member of the immunoglobulin superfamily.
7777537 1995 The Lutheran blood group glycoprotein, another member of the immunoglobulin superfamily, is widely expressed in human tissues and is developmentally regulated in human liver.
3810828 Evidence that the Lub blood group antigen is located on red cell membrane glycoproteins of 85 and 78 kd.
2907851 1988 The chromosome 19 linkage group LDLR, C3, LW, APOC2, LU, SE in man.