Property Summary

NCBI Gene PubMed Count 31
PubMed Score 69.54
PubTator Score 4931.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 4.8e-03
astrocytic glioma -1.500 3.8e-02
atypical teratoid / rhabdoid tumor -1.400 2.0e-04
ependymoma 1.200 1.4e-11
glioblastoma -1.500 2.1e-03
group 4 medulloblastoma -1.300 6.9e-04
malignant mesothelioma -1.400 4.4e-06
medulloblastoma, large-cell -2.600 2.4e-07
oligodendroglioma -1.600 4.0e-02
ovarian cancer -1.100 5.5e-08
tuberculosis 1.300 7.0e-06

Gene RIF (14)

AA Sequence

MSLFKARDWWSTILGDKEEFDQGCLCLANVDNSGNGQDKIIVGSFMGYLRIFSPHPAKTGDGAQAEDLLL      1 - 70
EVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQCQMKLMYEHNLQRTACNMTY     71 - 140
GSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLLPGPLAYSSRTDSFLTVSSCQQVESYKYQVL    141 - 210
AFATDADKRQETEQQKLGSGKRLVVDWTLNIGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFM    211 - 280
KKLDWSPSCFLPYCSVSEGTINTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLHDLKGVIVTLSD    281 - 350
DGHLQCSYLGTDPSLFQAPNVQSRELNYDELDVEMKELQKIIKDVNKSQGVWPMTEREDDLNVSVVVSPN    351 - 420
FDSVSQATDVEVGTDLVPSVTVKVTLQNRVILQKAKLSVYVQPPLELTCDQFTFEFMTPDLTRTVSFSVY    421 - 490
LKRSYTPSELEGNAVVSYSRPTDRNPDGIPRVIQCKFRLPLKLICLPGQPSKTASHKITIDTNKSPVSLL    491 - 560
SLFPGFASQSDDDQVNVMGFHFLGGARITVLASKTSQRYRIQSEQFEDLWLITNELILRLQEYFEKQGVK    561 - 630
DFACSFSGSIPLQEYFELIDHHFELRINGEKLEELLSERAVQFRAIQRRLLARFKDKTPAPLQHLDTLLD    631 - 700
GTYKQVIALADAVEENQGNLFQSFTRLKSATHLVILLIALWQKLSADQVAILEAAFLPLQEDTQELGWEE    701 - 770
TVDAAISHLLKTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLSTDAAAPQTMVMP    771 - 840
GGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQGVSE                           841 - 887
//

Text Mined References (31)

PMID Year Title