Property Summary

NCBI Gene PubMed Count 30
PubMed Score 10.36
PubTator Score 11.69

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.600 2.2e-03
astrocytic glioma -1.600 3.6e-02
Astrocytoma, Pilocytic -1.100 4.8e-03
atypical teratoid / rhabdoid tumor -2.000 2.6e-07
cystic fibrosis and chronic rhinosinusit... -1.101 1.5e-02
ependymoma -1.700 5.4e-08
glioblastoma -1.100 1.7e-03
malignant mesothelioma -1.700 6.0e-07
medulloblastoma -1.300 2.4e-03
medulloblastoma, large-cell -1.900 4.0e-06
oligodendroglioma -1.800 4.1e-02
ovarian cancer -1.100 4.4e-03
Pick disease -1.200 2.2e-03
Rheumatoid arthritis 1.400 2.9e-02

Gene RIF (8)

AA Sequence

MDLILNRMDYLQVGVTSQKTMKLIPASRHRATQKVVIGDHDGVVMCFGMKKGEAAAVFKTLPGPKIARLE      1 - 70
LGGVINTPQEKIFIAAASEIRGFTKRGKQFLSFETNLTESIKAMHISGSDLFLSASYIYNHYCDCKDQHY     71 - 140
YLSGDKINDVICLPVERLSRITPVLACQDRVLRVLQGSDVMYAVEVPGPPTVLALHNGNGGDSGEDLLFG    141 - 210
TSDGKLALIQITTSKPVRKWEIQNEKKRGGILCIDSFDIVGDGVKDLLVGRDDGMVEVYSFDNANEPVLR    211 - 280
FDQMLSESVTSIQGGCVGKDSYDEIVVSTYSGWVTGLTTEPIHKESGPGEELKINQEMQNKISSLRNELE    281 - 350
HLQYKVLQERENYQQSSQSSKAKSAVPSFGINDKFTLNKDDASYSLILEVQTAIDNVLIQSDVPIDLLDV    351 - 420
DKNSAVVSFSSCDSESNDNFLLATYRCQADTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKP    421 - 490
LSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECVTFYFQNTFLDTQLESTYRK    491 - 560
GEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALK    561 - 630
ELQIHEGNTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPLLLEIL    631 - 700
DSYDQNALISFFDAA                                                           701 - 715
//

Text Mined References (34)

PMID Year Title