Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.89
PubTator Score 0.50

Knowledge Summary


No data available


  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -2.100 7.9e-07
posterior fossa group B ependymoma 2.600 4.3e-12
atypical teratoid / rhabdoid tumor -1.400 3.2e-05
glioblastoma -1.600 5.6e-05
medulloblastoma, large-cell -1.600 1.5e-05
juvenile dermatomyositis -1.047 1.7e-12
adult high grade glioma -1.600 2.5e-04
group 4 medulloblastoma -1.200 3.2e-03
non primary Sjogren syndrome sicca 1.400 1.3e-02
nasopharyngeal carcinoma -1.900 7.9e-08


Accession Q8ND07 Q0P604 Q9H5P8
Symbols CCDC176


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

SKLQDKIFITQQIAISDSSGEVVLPTIPKEPQESDTGTF                                   491 - 529

Text Mined References (8)

PMID Year Title
23900544 2013 Bbof1 is required to maintain cilia orientation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.