Property Summary

Ligand Count 2
NCBI Gene PubMed Count 853
PubMed Score 248.41
PubTator Score 4544.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma 1.546 1.0e-04
cutaneous lupus erythematosus 1.100 6.7e-03
gastric carcinoma 1.500 2.8e-02
glioblastoma multiforme 1.400 5.9e-19
group 3 medulloblastoma 1.400 4.3e-02
medulloblastoma, large-cell -1.200 1.1e-04
osteosarcoma -1.212 3.4e-03
psoriasis -1.400 8.7e-05
spina bifida 1.050 3.5e-02
tuberculosis 1.100 4.6e-08

Protein-protein Interaction (1)

PDB (19)

Gene RIF (780)

AA Sequence

MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDEL      1 - 70
DSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWT     71 - 140
LDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG                      141 - 192
//

Text Mined References (863)

PMID Year Title