| Tbio | Basic leucine zipper transcriptional factor ATF-like 2 |
AP-1 family transcription factor that controls the differentiation of lineage-specific cells in the immune system. Following infection, participates in the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes (By similarity). Selectively suppresses CYR61/CCN1 transcription and hence blocks the downstream cell proliferation signals produced by CYR61 and inhibits CYR61-induced anchorage-independent growth and invasion in several cancer types, such as breast cancer, malignant glioma and metastatic melanoma. Possibly acts by interfering with AP-1 binding to CYR61 promoter.
Comments
| Disease | Target Count | P-value |
|---|---|---|
| psoriasis | 6685 | 8.8e-106 |
| juvenile dermatomyositis | 1189 | 4.7e-08 |
| sarcoidosis | 368 | 2.6e-05 |
| ulcerative colitis | 2087 | 2.9e-05 |
| urothelial carcinoma | 318 | 4.8e-05 |
| head and neck cancer | 270 | 3.3e-03 |
| active Crohn's disease | 918 | 8.5e-03 |
| tuberculosis | 1563 | 1.3e-02 |
| Multiple Sclerosis | 498 | 2.6e-02 |
| Disease | log2 FC | p |
|---|---|---|
| urothelial carcinoma | -1.100 | 4.8e-05 |
| juvenile dermatomyositis | 1.129 | 4.7e-08 |
| tuberculosis | 1.300 | 1.3e-02 |
| active Crohn's disease | 1.132 | 8.5e-03 |
| Multiple Sclerosis | 1.900 | 2.6e-02 |
| sarcoidosis | 1.400 | 2.6e-05 |
| ulcerative colitis | 1.400 | 2.9e-05 |
| head and neck cancer | 1.300 | 3.3e-03 |
| psoriasis | 3.000 | 8.8e-106 |
| PMID | Text | |
|---|---|---|
| 26977016 | BATF2 may exert selective pressure on the recombination machinery via a repetitive motif-based mechanism for the maintenance of heterochromatin stability. | |
| 26808579 | Results demonstrate that SARI is a novel target gene of glucocorticoid receptor, and the upregulation of SARI plays an important role in dexamethasone's killing effect on B lymphoma cells. | |
| 26376615 | Batf2 has a role in infectious diseases and cancer | |
| 26339361 | Suggest that SARI might play an important role in the occurrence and development of prostate cancer. IFN-beta might inhibit the growth of prostate cancer and promote cellular apoptosis by inducing the expression of SARI. | |
| 26135942 | In conclusion, as a tumor suppressor, BATF2 serves as a prognostic biomarker of esophageal squamous cell carcinoma and it may be a potential therapeutic target for ESCC treatment. | |
| 26022579 | these findings indicate that BATF2 status could be served as a potential biomarker to predict prognosis in colorectal cancer | |
| 25762344 | these novel findings suggest that BATF2, a tumor suppressor gene, is a potent negative regulator of HGF/MET signaling in colorectal cancer | |
| 24282278 | MDA-7/IL-24 has a role in cancer-specific apoptosis through SARI induction | |
| 24252932 | BATF2 plays a tumor-suppressor role in the development of oral tongue squamous cell carcinoma and BATF2 may serve as a prognostic biomarker and potential therapeutic target for this disease. | |
| 24133583 | SARI expression may predict a poor prognosis in non-small cell lung patients, and SARI may serve as a prognostic biomarker and potential therapeutic target for lung cancer. | |
| 23049725 | Loss of SARI expression initiates epithelial-to-mesenchymal transition (EMT), which is visualized by repression of E-cadherin and up-regulation of vimentin in lung adenocarcinoma cell lines and in clinical lung adenocarcinoma specimens. | |
| 21892628 | Data suggest that SARI as a potential therapeutic target in CML. | |
| 21867603 | BCR-ABL mediates the down-regulation of SARI mRNA expression in K562 cells. | |
| 20531301 | Inhibition of AP-1 by SARI negatively regulates transformation progression mediated by CCN1. | |
| 20473897 | Decreased expression of BATF2 is associated with hepatocellular carcinoma. |
MHLCGGNGLLTQTDPKEQQRQLKKQKNRAAAQRSRQKHTDKADALHQQHESLEKDNLALRKEIQSLQAEL 1 - 70 AWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGP 71 - 140 QPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLE 141 - 210 LEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF 211 - 274 //
| PMID | Year | Title | |
|---|---|---|---|
| 26977016 | 2016 | Discovery of a Regulatory Motif for Human Satellite DNA Transcription in Response to BATF2 Overexpression. | |
| 26808579 | 2016 | SARI, a novel target gene of glucocorticoid receptor, plays an important role in dexamethasone-mediated killing of B lymphoma cells. | |
| 26376615 | 2015 | Targeting Batf2 for infectious diseases and cancer. | |
| 26339361 | 2015 | Expression and mechanism of action of the SARI tumor suppressor in prostate cancer. | |
| 26135942 | 2015 | The tumor-suppressive role of BATF2 in esophageal squamous cell carcinoma. | |
| 26022579 | 2015 | BATF2 in human colorectal cancer. | |
| 25762344 | 2015 | BATF2 Deficiency Promotes Progression in Human Colorectal Cancer via Activation of HGF/MET Signaling: A Potential Rationale for Combining MET Inhibitors with IFNs. | |
| 24282278 | 2014 | Novel mechanism of MDA-7/IL-24 cancer-specific apoptosis through SARI induction. | |
| 24252932 | 2014 | Decreased expression of BATF2 is significantly associated with poor prognosis in oral tongue squamous cell carcinoma. | |
| 24133583 | 2013 | Decreased SARI expression predicts poor prognosis of Chinese patients with non-small cell lung cancer. | |
| 23049725 | 2012 | The function of SARI in modulating epithelial-mesenchymal transition and lung adenocarcinoma metastasis. | |
| 21988832 | 2011 | Toward an understanding of the protein interaction network of the human liver. | |
| 21892628 | 2011 | Transcription suppression of SARI (suppressor of AP-1, regulated by IFN) by BCR-ABL in human leukemia cells. | |
| 21867603 | 2011 | [Influence of BCR-ABL inhibitor STI571 on SARI expression in K562 cells]. | |
| 20531301 | 2010 | Inhibition of AP-1 by SARI negatively regulates transformation progression mediated by CCN1. | |
| 20473897 | 2011 | Decreased expression of BATF2 is associated with a poor prognosis in hepatocellular carcinoma. | |
| 19074269 | 2008 | Cloning and characterization of SARI (suppressor of AP-1, regulated by IFN). | |
| 19060904 | 2009 | An empirical framework for binary interactome mapping. | |
| 16713569 | 2006 | A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration. | |
| 16189514 | 2005 | Towards a proteome-scale map of the human protein-protein interaction network. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. |
