Property Summary

NCBI Gene PubMed Count 22
PubMed Score 131.62
PubTator Score 43.77

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
urothelial carcinoma -1.100 4.8e-05
juvenile dermatomyositis 1.129 4.7e-08
tuberculosis 1.300 1.3e-02
active Crohn's disease 1.132 8.5e-03
Multiple Sclerosis 1.900 2.6e-02
sarcoidosis 1.400 2.6e-05
ulcerative colitis 1.400 2.9e-05
head and neck cancer 1.300 3.3e-03
psoriasis 3.000 8.8e-106

Gene RIF (15)

PMID Text
26977016 BATF2 may exert selective pressure on the recombination machinery via a repetitive motif-based mechanism for the maintenance of heterochromatin stability.
26808579 Results demonstrate that SARI is a novel target gene of glucocorticoid receptor, and the upregulation of SARI plays an important role in dexamethasone's killing effect on B lymphoma cells.
26376615 Batf2 has a role in infectious diseases and cancer
26339361 Suggest that SARI might play an important role in the occurrence and development of prostate cancer. IFN-beta might inhibit the growth of prostate cancer and promote cellular apoptosis by inducing the expression of SARI.
26135942 In conclusion, as a tumor suppressor, BATF2 serves as a prognostic biomarker of esophageal squamous cell carcinoma and it may be a potential therapeutic target for ESCC treatment.
26022579 these findings indicate that BATF2 status could be served as a potential biomarker to predict prognosis in colorectal cancer
25762344 these novel findings suggest that BATF2, a tumor suppressor gene, is a potent negative regulator of HGF/MET signaling in colorectal cancer
24282278 MDA-7/IL-24 has a role in cancer-specific apoptosis through SARI induction
24252932 BATF2 plays a tumor-suppressor role in the development of oral tongue squamous cell carcinoma and BATF2 may serve as a prognostic biomarker and potential therapeutic target for this disease.
24133583 SARI expression may predict a poor prognosis in non-small cell lung patients, and SARI may serve as a prognostic biomarker and potential therapeutic target for lung cancer.
23049725 Loss of SARI expression initiates epithelial-to-mesenchymal transition (EMT), which is visualized by repression of E-cadherin and up-regulation of vimentin in lung adenocarcinoma cell lines and in clinical lung adenocarcinoma specimens.
21892628 Data suggest that SARI as a potential therapeutic target in CML.
21867603 BCR-ABL mediates the down-regulation of SARI mRNA expression in K562 cells.
20531301 Inhibition of AP-1 by SARI negatively regulates transformation progression mediated by CCN1.
20473897 Decreased expression of BATF2 is associated with hepatocellular carcinoma.

AA Sequence

MHLCGGNGLLTQTDPKEQQRQLKKQKNRAAAQRSRQKHTDKADALHQQHESLEKDNLALRKEIQSLQAEL      1 - 70
AWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGP     71 - 140
QPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLE    141 - 210
LEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF          211 - 274
//

Text Mined References (23)

PMID Year Title
26977016 2016 Discovery of a Regulatory Motif for Human Satellite DNA Transcription in Response to BATF2 Overexpression.
26808579 2016 SARI, a novel target gene of glucocorticoid receptor, plays an important role in dexamethasone-mediated killing of B lymphoma cells.
26376615 2015 Targeting Batf2 for infectious diseases and cancer.
26339361 2015 Expression and mechanism of action of the SARI tumor suppressor in prostate cancer.
26135942 2015 The tumor-suppressive role of BATF2 in esophageal squamous cell carcinoma.
26022579 2015 BATF2 in human colorectal cancer.
25762344 2015 BATF2 Deficiency Promotes Progression in Human Colorectal Cancer via Activation of HGF/MET Signaling: A Potential Rationale for Combining MET Inhibitors with IFNs.
24282278 2014 Novel mechanism of MDA-7/IL-24 cancer-specific apoptosis through SARI induction.
24252932 2014 Decreased expression of BATF2 is significantly associated with poor prognosis in oral tongue squamous cell carcinoma.
24133583 2013 Decreased SARI expression predicts poor prognosis of Chinese patients with non-small cell lung cancer.
23049725 2012 The function of SARI in modulating epithelial-mesenchymal transition and lung adenocarcinoma metastasis.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21892628 2011 Transcription suppression of SARI (suppressor of AP-1, regulated by IFN) by BCR-ABL in human leukemia cells.
21867603 2011 [Influence of BCR-ABL inhibitor STI571 on SARI expression in K562 cells].
20531301 2010 Inhibition of AP-1 by SARI negatively regulates transformation progression mediated by CCN1.
20473897 2011 Decreased expression of BATF2 is associated with a poor prognosis in hepatocellular carcinoma.
19074269 2008 Cloning and characterization of SARI (suppressor of AP-1, regulated by IFN).
19060904 2009 An empirical framework for binary interactome mapping.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.