Property Summary

NCBI Gene PubMed Count 24
PubMed Score 71.93
PubTator Score 29.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 3.1e-04
fibroadenoma 557 6.7e-04

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.700 3.1e-04
fibroadenoma 2.000 6.7e-04

 GO Component (2)

Gene RIF (8)

PMID Text
25540416 data strongly support a model in which EBNA3A is tethered to DNA through a BATF-containing protein complexes to enable continuous cell proliferation
25491772 Increased expression of the Th17-IL-6R/pSTAT3/BATF/RorgammaT-axis in the tumoural region of adenocarcinoma as compared to squamous cell carcinoma of the lung
24290279 increase expression in children with recurrent asthma
24216482 The activator protein 1 (AP1) family transcription factor BATF (B cell, activating transcription factor-like) was among the genes enriched in Th9 cells and was required for the expression of IL-9 and other Th9-associated genes.
20890291 PD-1 inhibits T cell function by upregulating BATF.
12809553 Phosphorylation of serine-43 converts BATF from a DNA binding into a non-DNA binding inhibitor of activator protein-1 activity.
12719594 up-regulated dramatically within 24 h following the infection of established and primary human B cells with EBV by the action of EBNA2 and activated Notch protein
12594265 Overexpression of human BATF in transgenic mice disrupts the development of thymus-derived NKT cells

AA Sequence

MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRK      1 - 70
EIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP                    71 - 125
//

Text Mined References (24)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25540416 2015 Epstein-Barr virus nuclear antigen 3A partially coincides with EBNA3C genome-wide and is tethered to DNA through BATF complexes.
25491772 2014 Increased expression of the Th17-IL-6R/pSTAT3/BATF/Ror?T-axis in the tumoural region of adenocarcinoma as compared to squamous cell carcinoma of the lung.
25416956 2014 A proteome-scale map of the human interactome network.
24290279 2014 The activating protein 1 transcription factor basic leucine zipper transcription factor, ATF-like (BATF), regulates lymphocyte- and mast cell-driven immune responses in the setting of allergic asthma.
24216482 2013 Th9 cell development requires a BATF-regulated transcriptional network.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
20890291 2010 Transcriptional analysis of HIV-specific CD8+ T cells shows that PD-1 inhibits T cell function by upregulating BATF.
20453842 2010 Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
18692475 2008 A protein domain-based interactome network for C. elegans early embryogenesis.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12809553 2003 Phosphorylation of BATF regulates DNA binding: a novel mechanism for AP-1 (activator protein-1) regulation.
12719594 2003 EBNA2 and activated Notch induce expression of BATF.
12594265 2003 BATF transgenic mice reveal a role for activator protein-1 in NKT cell development.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10777209 2000 B-ATF functions as a negative regulator of AP-1 mediated transcription and blocks cellular transformation by Ras and Fos.
9745044 1998 Genomic organization of human B-ATF, a target for regulation by EBV and HTLV-1.
8954125 1996 IFP 35 forms complexes with B-ATF, a member of the AP1 family of transcription factors.
8630063 1996 SFA-2, a novel bZIP transcription factor induced by human T-cell leukemia virus type I, is highly expressed in mature lymphocytes.
8570175 1995 B-ATF: a novel human bZIP protein that associates with members of the AP-1 transcription factor family.