Property Summary

NCBI Gene PubMed Count 27
PubMed Score 76.51
PubTator Score 47.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.576 6.3e-04
chronic lymphocytic leukemia -1.599 2.5e-04
astrocytic glioma -1.700 4.3e-03
ependymoma -2.100 1.5e-02
oligodendroglioma -1.500 2.8e-10
glioblastoma multiforme -2.200 2.2e-17
atypical teratoid / rhabdoid tumor -2.300 3.2e-03
Duchenne muscular dystrophy 1.053 1.4e-06
tuberculosis and treatment for 3 months -2.100 4.4e-06
primary pancreatic ductal adenocarcinoma 2.768 6.2e-05
lung cancer -2.200 2.1e-05
pancreatic cancer 2.900 1.8e-05
interstitial cystitis 1.300 3.6e-03
cystic fibrosis 1.500 2.7e-04
adult high grade glioma -1.800 3.4e-06
pilocytic astrocytoma -1.300 8.7e-08
primary Sjogren syndrome 2.600 7.9e-06
nasopharyngeal carcinoma -1.300 3.3e-03
Breast cancer 1.500 4.0e-04
mucosa-associated lymphoid tissue lympho... 1.289 1.9e-02
ductal carcinoma in situ 1.600 1.1e-03
invasive ductal carcinoma 1.100 7.8e-03
ulcerative colitis 3.600 1.2e-06
ovarian cancer -3.000 2.2e-10

Gene RIF (11)

PMID Text
25919928 Data suggest methylation status of gene promoters for BASP1 (brain abundant membrane attached signal protein 1) and CDH11 (cadherin 11) in tumor, skin, and metastatic tumor tissue may serve as prognostic biomarkers in patients with advanced melanoma.
24350992 Sequestration by BASP1 renders cells increasingly resistant to abrin toxicity.
24166496 Findings provide new insights into the function of prohibitin in transcriptional regulation and uncover a BASP1-prohibitin complex that plays an essential role in the PIP2-dependent recruitment of chromatin remodeling activities to the promoter.
23898208 HIV-1 Tat upregulates the expression of brain membrane attached signal protein 1 (BASP1) in human primary T cells
22939983 Repression of transcription by WT1-BASP1 requires the myristoylation of BASP1 and the PIP2-dependent recruitment of histone deacetylase.
21269271 Results suggest that BASP1 and WT1 play concerted, central roles in directing cell fate during differentiation. Here, BASP1/WT1 work to divert K562 cells away from blood cell lineage toward neuron phenotype.
19956849 BASP1 and SRD5A2 are methylated in early hepatocellular carcinoma
19376485 BASP1 and TPPsig-BASP1 genes were not involved in the etiology of Mobius syndrome.
18949357 Identification of novel aberrant methylation of BASP1 and SRD5A2 for early diagnosis of hepatocellular carcinoma by genome-wide search.
18268500 proteomic assessments of membrane microdomains in prefrontal cortex and validation in two brain series, strongly implicates LAMP, STXBP1 and BASP1 in schizophrenia and supports the view of a neuritic and synaptic dysfunction in the neuropathology
14701728 BASP1 can confer WT1 cosuppressor activity in transfection assays, and elimination of endogenous BASP1 expression augments transcriptional activation by WT1.

AA Sequence

MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAAAEPAEAKEGKEKPDQDAEGKAEEKE      1 - 70
GEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPAAGGEAPKAAEAAAAPAESAAPAAGEE     71 - 140
PSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPKAQGPAASAEEPK    141 - 210
PVEAPAANSDQTVTVKE                                                         211 - 227
//

Text Mined References (38)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25919928 2015 Novel DNA methylation markers with potential prognostic relevance in advanced malignant melanoma identified using COBRA assays.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24350992 2014 Sequestration of the abrin A chain to the nucleus by BASP1 increases the resistance of cells to abrin toxicity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24166496 2014 Prohibitin is required for transcriptional repression by the WT1-BASP1 complex.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23092984 2012 Genome-wide association of mood-incongruent psychotic bipolar disorder.
22939983 2012 Repression of transcription by WT1-BASP1 requires the myristoylation of BASP1 and the PIP2-dependent recruitment of histone deacetylase.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21269271 2011 WT1 and its transcriptional cofactor BASP1 redirect the differentiation pathway of an established blood cell line.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19956849 2010 The assessment of methylated BASP1 and SRD5A2 levels in the detection of early hepatocellular carcinoma.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19376485 2009 Mutational screening of BASP1 and transcribed processed pseudogene TPPsig-BASP1 in patients with Möbius syndrome.
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19050011 2009 Dynamic interaction between WT1 and BASP1 in transcriptional regulation during differentiation.
18949357 2008 Identification of novel aberrant methylation of BASP1 and SRD5A2 for early diagnosis of hepatocellular carcinoma by genome-wide search.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18268500 2009 Proteomic analysis of membrane microdomain-associated proteins in the dorsolateral prefrontal cortex in schizophrenia and bipolar disorder reveals alterations in LAMP, STXBP1 and BASP1 protein expression.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701728 2004 BASP1 is a transcriptional cosuppressor for the Wilms' tumor suppressor protein WT1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10965107 2000 Assignment of brain acid-soluble protein 1 (BASP1) to human chromosome 5p15.1-->p14, differential expression in human cancer cell lines as a result of alterations in gene dosage.
9749536 1998 Characterization of bovine and human cDNAs encoding NAP-22 (22 kDa neuronal tissue-enriched acidic protein) homologs.
9310187 1997 The BASP1 family of myristoylated proteins abundant in axonal termini. Primary structure analysis and physico-chemical properties.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.