Property Summary

NCBI Gene PubMed Count 143
PubMed Score 120.71
PubTator Score 142.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Breast Neoplasms 423 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.0
Disease Target Count Z-score Confidence
Neuroblastoma 79 0.0 3.0
Organ system cancer 18 0.0 3.0
Disease Target Count Z-score Confidence
Breast cancer 3469 0.0 5.0
ovarian cancer 8297 0.0 5.11089508702518E-4
Disease Target Count Z-score Confidence
Cancer 2388 4.453 2.2
Disease Target Count
Familial cancer of breast 12

Expression

Protein-protein Interaction (2)

Gene RIF (116)

AA Sequence

MPDNRQPRNRQPRIRSGNEPRSAPAMEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREPVCLGGCEHIF      1 - 70
CSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNELSDLKEDKPRKSLFNDAGNKK     71 - 140
NSIKMWFSPRSKKVRYVVSKASVQTQPAIKKDASAQQDSYEFVSPSPPADVSERAKKASARSGKKQKKKT    141 - 210
LAEINQKWNLEAEKEDGEFDSKEESKQKLVSFCSQPSVISSPQINGEIDLLASGSLTESECFGSLTEVSL    211 - 280
PLAEQIESPDTKSRNEVVTPEKVCKNYLTSKKSLPLENNGKRGHHNRLSSPISKRCRTSILSTSGDFVKQ    281 - 350
TVPSENIPLPECSSPPSCKRKVGGTSGRKNSNMSDEFISLSPGTPPSTLSSSSYRRVMSSPSAMKLLPNM    351 - 420
AVKRNHRGETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTT    421 - 490
GYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMKSLLLLPEKNESSSASHCSVM    491 - 560
NTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWI    561 - 630
LKFEWVKACLRRKVCEQEEKYEIPEGPRRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGG    631 - 700
QILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSF    701 - 770
ELLPLDS                                                                   771 - 777
//

Text Mined References (150)

PMID Year Title