Property Summary

NCBI Gene PubMed Count 141
PubMed Score 107.16
PubTator Score 226.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.100 2.2e-02
subependymal giant cell astrocytoma -1.414 4.0e-02

Protein-protein Interaction (3)

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
436 screening 346 / 0 / 71191 HTS for BAP1 Enzyme inhibitors
714 confirmatory 12 / 0 / 30 BAP1 Enzyme inhibitors Dose Response Confirmation
753 confirmatory 23 / 20 / 266 BAP1 Enzyme inhibitors secondary assay confirmation
1068 confirmatory 6 / 0 / 29 BAP1 Enzyme inhibitors AMC/RHO Comparison
1134 confirmatory 32 / 0 / 0 BAP1 Enzyme Inhibitors Dose Response Confirmation and Selectivity Assay using ubiquitin-rhodamine(110)-glycine

Gene RIF (117)

PMID Text
27116551 mutation is the most significant prognostic predictor of metastasis in polyploidy uveal melanoma
27067777 loss of BAP1 expression can be used to very strongly support a pathological diagnosis of abdominal mesothelioma over serous carcinoma
26982343 We conclude that, in contrast to intrahepatic cholangiocarcinoma, loss of expression of BAP1 occurs very rarely in pancreatic ductal adenocarcinoma. Therefore BAP1 inactivation is unlikely to be a frequent driver abnormality in pancreatic adenocarcinoma
26900815 BAP1 immunohistochemistry is relatively insensitive in the context of differential diagnosis of sarcomatous and desmoplastic mesotheliomas.
26774355 identifies a new BAP1 mutation, further highlights the relevance of BAP1 as a clinically important tumor suppressor gene, and broadens the range of cancers associated with BAP1 inactivation
26765459 absent expression in intrahepatic cholangiocarcinoma associated with improved prognosis, higher histological grade
26739236 This study showed that the BAP1 C-terminal extension is important for H2A deubiquitination but needs to be activated by the DEUBAD domains of ASXL1 or its relatives.
26719535 Many tumors harboring BAP1 germline mutations were associated with BAP1 syndrome, including mesothelioma and ocular/cutaneous melanomas, as well as renal, breast, lung, gastric, and basal cell carcinomas.
26701415 Whole-exome sequencing of these lesions revealed the acquisition of BAP1 and TP53 mutations during tumor evolution, thereby unmasking clonal heterogeneity and allowing the identification of cooperating genes within the same tumor.
26683624 once a proband is identified, extended analyses of these kindreds, using genomic and genealogical studies to identify the most recent common ancestor, allow investigators to uncover additional branches of the family that may carry BAP1 mutations.
26645730 Cellular blue nevi showed normal positive IHC staining for BAP1. Loss of BAP1 IHC expression was restricted to melanomas. including all metastatic cases
26496992 The diagnosis was an amelanotic choroidal melanoma: stage T2aN0M0 in the right eye, a naevus in the left eye and ocular melanocytosis.
26452128 Use bioinformatic tools to predict the molecular effects of all mutations lying in BAP1 genes.
26448191 BAP1 immunohistochemistry provides a reliable marker of mesothelial malignancy in effusion cytology specimens.
26437366 Bap1 loss leads cell proliferation and malignant transformation via histone methylation and gene expression.
26419610 BAP1 interacts directly with KLF5 and stabilizes KLF5 via deubiquitination.
26416890 inactivation of the BAP1/ASXL2 axis might contribute to cancer development.
26409435 study reports a high-risk cancer family with multiple mesotheliomas, cutaneous melanomas, basal cell carcinomas, and meningiomas segregating with a germline nonsense mutation in BAP1 (c.1938T>A; p.Y646X)
26376834 BAP1 loss is frequent in epithelioid malignant mesothelioma, which is in turn associated with improved survival.
26300492 BAP1 loss and MCRS1 down-regulation in renal cell carcinoma are associated with adverse clinicopathological features.
26300218 BAP1 expression identified 4 clinical subgroups of patients with clear cell renal cell carcinoma who had divergent clinical outcomes.
26246155 Unusually high frequency of large deletions indicates that the 3p21 chromosomal region surrounding BAP1 gene is structurally unstable.
26226841 conclude that loss of BAP1 expression, while not definitive, can be used to support the diagnosis of mesothelioma in effusion cytology
26191197 Suggest that cytoplasmic expression of BAP1 might serve as a valuable predictive biomarker of the prognosis in gliomas.
26118501 These results demonstrate BAP1 as a major link with the BCR-ABL-induced downregulation of BRCA1 in CML.
26022455 BAP1 protein is frequently lost in mesothelioma, especially of epithelioid/biphasic subtype and is commonly associated with homozygous BAP1 deletion.
26011428 Our results suggested that, whereas wild-type BAP1 suppresses Malignant mesothelioma cell proliferation and restores cell survival, some mutant BAP1 may also moderately retain these functions.
25976137 Known or suspected risk factors for UM, the cancer risk in UM patients and their family members, and the genes that have been reported to predispose to UM.
25974357 Germline BAP1 mutations occur infrequently in uveal melanoma and are associated with larger tumors and higher rates of ciliary body involvement, 2 known risk factors for metastasis.
25972334 Loss of BAP1 expression could be associated with the development of basal cell carcinomas in patients with germline BAP1 mutations
25970771 BAP1 regulates HDAC2 by increasing transcript abundance, rather than opposing its ubiquitylation.
25952750 The authors established mesothelioma patient derived tumor xenografts with BAP1 mutation that mimic the molecular characteristics in patient tumors. It can be used for studying novel drug regimens and the functional aspects of BAP1 in mesothelioma.
25938359 we have demonstrated that loss of IHC staining for BAP1 identifies a distinct subgroup of mesotheliomas with the same features previously associated with double hit mutation/inactivation of BAP1
25889843 These findings suggest a major role for BAP1 in peritoneal malignant mesothelioma susceptibility.
25830670 BAP1 c.2054 A&T (p.E685V) variant is a pathogenic mutation and contributes to MPM through disruption of normal splicing
25796603 Sporadic germline BAP1 mutations are not relevant to the genetic susceptibility of malignant mesothelioma.
25787093 Prevalence of Germline BAP1, CDKN2A, and CDK4 Mutations in an Australian Population-Based Sample of Cutaneous Melanoma Cases
25687217 This study suggests that a small subset of patients with early onset UM has germline mutation in BAP1.
25658628 Our findings conclusively establish BAP1 as the most commonly mutated gene in MM, regardless of ethnic background or other clinical characteristics.
25636086 The subsequent validation study on 68 LCBs identified recurrent mutations in TERT promoter, chromatin regulators (BAP1, PBRM1 and ARID2), a synapse organization gene (PCLO), IDH genes and KRAS.
25521456 BAP1 may have a growth-sustaining role in melanoma cells, but its impact on ubiquitination underpins a complex physiology, which is context and cell dependent
25506912 The mechanism by which loss of BAP1 promotes metastasis of uveal melanoma cells is shown.
25488749 Integrative analysis of mutations and somatic copy-number alterations revealed frequent genetic alterations in BAP1, NF2, CDKN2A, and CUL1 in pleural mesothelioma.
25479927 The combined BAP1-BRAFV600E+ immunoprofile appears to be a constant feature of BAP1 tumor syndrome-associated melanocytic lesions
25468148 taking into account previous similar screenings, the prevalence of germline BAP1 mutations in sporadic malignant pleural mesothelioma (MPM) patients can be estimated around 1-2%, suggesting a minor role of germline BAP1 mutation in the pathogenesis of sporadic MPM
25465300 Data suggest biallelic inactivation of PBRM1 or BAP1 is less common in non-ccRCC when compared with ccRCC tumors. Findings suggest loss of PBRM1 or BAP1 are key events in ccRCC, whereas other pathways may support tumorigenesis in non-ccRCC subtypes.
25451922 BAP1 deficiency causes increased expression of FoxK2 target genes in a Ring1B-Bmi1-dependent manner
25380601 BAP1 mutations cause a new cancer syndrome, with a high rate of malignant mesothelioma.
25283999 INO80 is stabilized and targeted to replication forks by BAP1 during normal DNA synthesis but downregulated in BAP1 defective cancer cells
25231345 BAP1 mutations are rare in patients with sporadic malignant mesothelioma MM, and we report a new BAP1 mutation, extend the cancer types associated with these mutations, and suggest the existence of other unknown genes in the pathogenesis of familial MM.
25228651 a new mechanism for BAP1 involved in deubiquitination of gamma-tubulin, which is required to prevent abnormal mitotic spindle formation and genome instability.
25225168 A recurrent germline BAP1 mutation and extension of the BAP1 tumor predisposition spectrum to include basal cell carcinoma
25225064 This study is the first to identify frequent BAP1 and BRCA pathway alterations in bladder cancer, show TERT promoter alterations are independent of other bladder cancer gene alterations, and show KDM6A loss is a driver of the bladder cancer phenotype.
25147369 Loss of BAP1 expression associated well with all of the methods currently used for prognostication and was itself predictive of death due to metastasis in uveal melanoma after enucleation
25080371 our observations suggest that BCCs are part of the BAP1 cancer syndrome, perhaps in relation with chronic sun exposure and melanocortin 1 receptor (MC1R) variants.
25058347 BAP1 protein expression is an independent survival predictor for uveal melanoma patients.
24970262 BAP1 mutations were associated with significantly increased odds of metastasis in uveal melanoma.
24938780 The pathogenesis of Wiesner nevus is based on a loss of expression of the BAP1 gene.
24894717 BAP1 functions as part of the DNA damage response - mediates rapid poly(ADP-ribose)-dependent recruitment of the polycomb deubiquitylase complex PR-DUB to sites of DNA damage
24705312 We characterized the BAP1 status in 17 ambiguous melanocytic tumors with a single genomic event involving loss of BAP1
24703950 UBE2O defines an atypical ubiquitin-signaling pathway that coordinates the function of BAP1.
24697775 Uveal melanoma and the BAP1 cancer syndrome raise awareness in the predisposition of hereditary cancer syndrome.
24511587 Gene expression profiling for uveal melanoma may be obtained from patients who were previously treated with radiotherapy
24382589 This study used a large patient cohort to demonstrate that BAP1 expression is an independent marker of prognosis in patients with low-risk (SSIGN</= 3) ccRCC.
24373783 Immunohistochemically, Wiesner nevus is BAP1 negative and VE1 positive.
24347639 BAP1 has an important role in DSB repair by homologous recombination, which is a possible molecular basis for its tumor suppressor function
24247622 Analysis of BAP1 protein expression using immunohistochemistry may serve as a rapid and cost-effective means of identifying uveal melanoma patients with aggressive disease, who can then be managed appropriately.
24243779 The results of this study confirm the association between germline BAP1 mutation and predisposition to UM, mesothelioma, CM and RCC.
24211834 A model whereby stress induced phosphorylation functions to displace BAP1 from specific promoters. This may regulate the transcription of a subset of genes involved in the response to DNA damage.
24187051 We detected a cosegregating BAP1 germline mutation in two family members with UM. This suggests that, consistent with a classic tumour suppressor model, carriers of damaging mutations in BAP1 are predisposed to UM.
24185509 Frequent inactivating mutations in multiple chromatin-remodeling genes (including BAP1, ARID1A and PBRM1), and mutation in one of these genes occurred in almost half of the carcinomas sequenced.
24166983 BAP1-mutated tumors are associated with metastatic clear cell renal cell carcinoma.
24128712 High BAP1 mutations are associated with smoking in malignant pleural mesothelioma.
24076305 In clear cell renal carcinoma, BAP1 loss was associated with adverse clinicopathological variables, including high Fuhrman grade, advanced pT stage, sarcomatoid dedifferentiation and necrosis.
24029645 Mutation frequencies among CT images of clear cell RCCs were as follows: BAP1, 6.0% (14 of 233).
24018818 loss of expression of BAP1 occurs in a small proportion (~5%) of cutaneous melanomas
23977234 BAP1 is an important uveal and cutaneous melanoma tumor suppressor gene.
23963927 BAP1 expression was not associated with asbestos exposure.
23915344 BAP1 appears to function in the uveal melanocyte lineage primarily as a regulator of differentiation, with cells deficient for BAP1 exhibiting stem-like qualities.
23867514 the evidence that implicated PBRM1 and BAP1 as renal cancer driver genes, provide an update on the function of the gene products, and speculate on how mutations in these genes may be exploited therapeutically
23849051 study describes a family with a novel germline BAP1 nonsense mutation, c.723T>G, which leads to a predicted truncated protein, p.Y241*, or nonsense-mediated decay of the BAP1 mRNA; the proband had uveal melanoma and his paternal family has a remarkable history of multiple cancers
23709298 Findings suggest that BAP1 is an early-onset familial Renal cell carcinoma (RCC) predisposing gene; BAP1 mutations may drive tumor development in a subset of patients with inherited renal cell cancer
23684012 BAP1 mutations are associated with the genetic cause of some familial nonsyndromic renal cell carcinomas.
23644518 PBRM1, KDM6A, SETD2 and BAP1 were unmethylated in all tumor and normal specimens.
23620406 BAP1 and SETD2 mutations (6%-12%) are associated with worse cancer-specific survival , suggesting their roles in disease progression.
23495950 Clumped perinuclear BAP1 expression is a frequent finding in sporadic epithelioid Spitz tumors.
23341325 Data show that exome sequencing of germline DNA from members of the affected family indicate a loss-of-function mutation in the BAP1 gene.
23333114 The median overall survival in the UTSW cohort was significantly shorter for patients with BAP1-mutant tumours (4.6 years; 95% CI 2.1-7.2), than for patients with PBRM1-mutant tumours (10.6 years; 9.8-11.5).
23277170 If a BAP1 mutation is confirmed in a tumour, the patient's treating physician should be informed of the possibility of a BAP1 germline mutation.
23171164 The study revealed that 2/66 (3%) unselected uveal melanoma cases had novel mutations in BAP1 that may have contributed to their disease risk.
23032617 BAP1 germline mutation carriers are predisposed to the development of melanocytic skin lesions, uveal and cutaneous melanoma, and mesothelioma with varying degrees of penetrance.
23026932 We report a series of 8 combined melanocytic lesions, in which a dominant large epithel-ioid cell proliferation with loss of BAP1 expression was associated and intimately admixed with a BAP1-positive conventional nevus.
22958294 somatic mutation in a BAP1 TSG may be rare or absent in these carcinomas; somatic mutational events in BAP1 may not contribute to development of these carcinomas.
22935333 Germline BAP1 mutations are associated with a novel cancer syndrome characterized by malignant mesothelioma, uveal melanoma, cutaneous melanoma and MBAITs, and possibly by other cancers
22889334 These findings further support BAP1 as a melanoma susceptibility gene and extend the potential predisposition spectrum to paraganglioma.
22878500 results identify a potent tumor suppressor function for BAP1 in myeloid neoplasia; a BAP1 catalytic mutation found in a myelodysplastic syndrome patient implies that BAP1 loss of function has similar consequences in mice and humans
22863556 BAP1 may be a useful prognostic factor of NSCLC patients and potential target for anticancer drugs.
22683710 BAP1 loss sensitizes RCC cells in vitro to genotoxic stress.
22545102 Germline BAP1 mutations are associated with a more aggressive ocular melanoma phenotype and a recurrent phenotypic complex of cutaneous/ocular melanoma.
22367297 A distinct subset of atypical Spitz tumors is characterized by BRAF mutation and loss of BAP1 expression.
22321046 These results suggest that the lack of the tumor suppressor BAP1 may be more specifically involved in the pathogenesis of epithelioid MM rather than non-epithelioid MM.
21941004 Biallelic inactivation of BAP1 is observed in uveal melanoma, lung adenocarcinoma and meningioma.
21874003 Loss of BAP1 is associated with a clinically and morphologically distinct type of melanocytic neoplasm.
21874000 These results identify a BAP1-related cancer syndrome that is characterized by mesothelioma and uveal melanoma.
21642991 The nuclear deubiquitinase BAP1 is commonly inactivated by somatic mutations and 3p21.1 losses in malignant pleural mesothelioma.
21484256 Studies suggest that BAP1 influences cell proliferation at G1/S by co-regulating transcription from HCF-1/E2F-governed promoters.
21051595 findings implicate loss of BAP1 in uveal melanoma metastasis and suggest that the BAP1 pathway may be a valuable therapeutic target
20805357 HCF-1 interacts with the middle region of YY1 encompassing the glycine-lysine-rich domain and is essential for the formation of a ternary complex with YY1 and BAP1 in vivo.
20436459 BAP1 is the catalytic subunit of the PR-DUB polycomb complex
19950226 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19815555 BAP1 regulates cell proliferation by deubiquitinating HCF-1
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19197335 Four genes encoding BRCA1-interacting proteins were analyzed in a cohort of 96 breast cancer individuals from high-risk non-BRCA1/BRCA2 French Canadian families.
19197335 Observational study of gene-disease association. (HuGE Navigator)
19117993 Results suggest that BAP1 and BRCA1/BARD1 coordinately regulate ubiquitination during the DNA damage response and the cell cycle.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18757409 identification of the deubiquitinating enzyme BAP1 as a tumor suppressor may lead to further understanding of how the ubiquitin proteasome system contributes to cancer and aid in the identification of new targets for cancer therapy

AA Sequence

MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRRKVSTLVDDTS      1 - 70
VIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKA     71 - 140
HNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVI    141 - 210
MERIGLATAGEPYHDIRFNLMAVVPDRRIKYEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQ    211 - 280
LPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNP    281 - 350
TPIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDYEDDEEDDVQNTNSALRYKG    351 - 420
KGTGKPGALSGSADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSN    421 - 490
ESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTG    491 - 560
LLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMVRPGEPLSGEKYSPK    561 - 630
ELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRR    631 - 700
RQGVSIGRLHKQRKPDRRKRSRPYKAKRQ                                             701 - 729
//

Text Mined References (149)

PMID Year Title
27116551 2016 Metastatic Disease in Polyploid Uveal Melanoma Patients Is Associated With BAP1 Mutations.
27067777 2016 Loss of BAP1 expression is very rare in peritoneal and gynecologic serous adenocarcinomas and can be useful in the differential diagnosis with abdominal mesothelioma.
26982343 2016 Loss of BAP1 Expression Is Very Rare in Pancreatic Ductal Adenocarcinoma.
26900815 2016 BAP1 Immunohistochemistry and p16 FISH in the Diagnosis of Sarcomatous and Desmoplastic Mesotheliomas.
26774355 2016 A novel BAP1 mutation is associated with melanocytic neoplasms and thyroid cancer.
26765459 2016 Loss of BAP1 Expression Occurs Frequently in Intrahepatic Cholangiocarcinoma.
26739236 2016 BAP1/ASXL1 recruitment and activation for H2A deubiquitination.
26719535 2016 Germline BAP1 Mutational Landscape of Asbestos-Exposed Malignant Mesothelioma Patients with Family History of Cancer.
26701415 2016 Genetic evolution of nevus of Ota reveals clonal heterogeneity acquiring BAP1 and TP53 mutations.
26683624 2015 Combined Genetic and Genealogic Studies Uncover a Large BAP1 Cancer Syndrome Kindred Tracing Back Nine Generations to a Common Ancestor from the 1700s.
26680512 2015 Cancer associated missense mutations in BAP1 catalytic domain induce amyloidogenic aggregation: A new insight in enzymatic inactivation.
26645730 2016 Melanomas Associated With Blue Nevi or Mimicking Cellular Blue Nevi: Clinical, Pathologic, and Molecular Study of 11 Cases Displaying a High Frequency of GNA11 Mutations, BAP1 Expression Loss, and a Predilection for the Scalp.
26496992 2016 Bilateral uveal melanomas with different gene expression detected with 7 years interval.
26452128 2015 Computational analysis of the mutations in BAP1, PBRM1 and SETD2 genes reveals the impaired molecular processes in renal cell carcinoma.
26448191 2016 Utility of BAP1 Immunohistochemistry and p16 (CDKN2A) FISH in the Diagnosis of Malignant Mesothelioma in Effusion Cytology Specimens.
26437366 2015 Loss of BAP1 function leads to EZH2-dependent transformation.
26419610 2015 BAP1 promotes breast cancer cell proliferation and metastasis by deubiquitinating KLF5.
26416890 2015 The BAP1/ASXL2 Histone H2A Deubiquitinase Complex Regulates Cell Proliferation and Is Disrupted in Cancer.
26409435 2015 Germline BAP1 mutation in a family with high incidence of multiple primary cancers and a potential gene-environment interaction.
26376834 2015 BAP1 facilitates diagnostic objectivity, classification, and prognostication in malignant pleural mesothelioma.
26300492 2015 Stabilization of MCRS1 by BAP1 prevents chromosome instability in renal cell carcinoma.
26300218 2016 Clear Cell Renal Cell Carcinoma Subtypes Identified by BAP1 and PBRM1 Expression.
26246155 2015 Frequent genomic rearrangements of BRCA1 associated protein-1 (BAP1) gene in Japanese malignant mesothelioma-characterization of deletions at exon level.
26226841 2015 Loss of expression of BAP1 is a useful adjunct, which strongly supports the diagnosis of mesothelioma in effusion cytology.
26191197 2015 Cytoplasmic expression of BAP1 as an independent prognostic biomarker for patients with gliomas.
26118501 2015 The downregulation of BAP1 expression by BCR-ABL reduces the stability of BRCA1 in chronic myeloid leukemia.
26022455 2015 BAP1 (BRCA1-associated protein 1) is a highly specific marker for differentiating mesothelioma from reactive mesothelial proliferations.
26011428 2015 Functional differences between wild-type and mutant-type BRCA1-associated protein 1 tumor suppressor against malignant mesothelioma cells.
25976137 2015 The genetic basis of uveal melanoma.
25974357 2015 Clinical Characteristics of Uveal Melanoma in Patients With Germline BAP1 Mutations.
25972334 2015 Loss of BAP1 Expression in Basal Cell Carcinomas in Patients With Germline BAP1 Mutations.
25970771 2015 Loss of the deubiquitylase BAP1 alters class I histone deacetylase expression and sensitivity of mesothelioma cells to HDAC inhibitors.
25952750 2015 Mesothelioma patient derived tumor xenografts with defined BAP1 mutations that mimic the molecular characteristics of human malignant mesothelioma.
25938359 2015 Loss of expression of BAP1 predicts longer survival in mesothelioma.
25889843 2015 BAP1 mutation is a frequent somatic event in peritoneal malignant mesothelioma.
25830670 2015 BAP1 missense mutation c.2054 A>T (p.E685V) completely disrupts normal splicing through creation of a novel 5' splice site in a human mesothelioma cell line.
25796603 2015 Absence of germline mutations in BAP1 in sporadic cases of malignant mesothelioma.
25787093 2015 Prevalence of Germline BAP1, CDKN2A, and CDK4 Mutations in an Australian Population-Based Sample of Cutaneous Melanoma Cases.
25687217 2015 Analysis of BAP1 Germline Gene Mutation in Young Uveal Melanoma Patients.
25658628 2015 High Incidence of Somatic BAP1 alterations in sporadic malignant mesothelioma.
25636086 2015 Whole-genome mutational landscape of liver cancers displaying biliary phenotype reveals hepatitis impact and molecular diversity.
25521456 2015 BAP1 has a survival role in cutaneous melanoma.
25506912 2014 Uveal melanoma cells utilize a novel route for transendothelial migration.
25488749 2015 Whole-exome sequencing reveals frequent genetic alterations in BAP1, NF2, CDKN2A, and CUL1 in malignant pleural mesothelioma.
25479927 2015 BAP1 and BRAFV600E expression in benign and malignant melanocytic proliferations.
25468148 2015 Prevalence of BRCA-1 associated protein 1 germline mutation in sporadic malignant pleural mesothelioma cases.
25465300 2015 Loss of PBRM1 and BAP1 expression is less common in non-clear cell renal cell carcinoma than in clear cell renal cell carcinoma.
25451922 2015 BRCA1-associated protein 1 (BAP1) deubiquitinase antagonizes the ubiquitin-mediated activation of FoxK2 target genes.
25380601 2015 Mesothelioma patients with germline BAP1 mutations have 7-fold improved long-term survival.
25283999 2014 Stabilization and targeting of INO80 to replication forks by BAP1 during normal DNA synthesis.
25231345 2015 Inference on germline BAP1 mutations and asbestos exposure from the analysis of familial and sporadic mesothelioma in a high-risk area.
25228651 2014 Deubiquitination of ?-tubulin by BAP1 prevents chromosome instability in breast cancer cells.
25225168 2015 A recurrent germline BAP1 mutation and extension of the BAP1 tumor predisposition spectrum to include basal cell carcinoma.
25225064 2014 Concurrent alterations in TERT, KDM6A, and the BRCA pathway in bladder cancer.
25147369 2014 Prognostic parameters in uveal melanoma and their association with BAP1 expression.
25080371 2015 Germline BAP1 mutations predispose also to multiple basal cell carcinomas.
25058347 2014 Lack of BAP1 protein expression in uveal melanoma is associated with increased metastatic risk and has utility in routine prognostic testing.
24970262 2014 Chromosome 3 status combined with BAP1 and EIF1AX mutation profiles are associated with metastasis in uveal melanoma.
24938780 2014 [Wiesner nevus: a new melanocytic tumor defined by molecular genetic analysis].
24894717 2014 Germline mutations in BAP1 impair its function in DNA double-strand break repair.
24705312 2014 Ambiguous melanocytic tumors with loss of 3p21.
24703950 2014 Autodeubiquitination protects the tumor suppressor BAP1 from cytoplasmic sequestration mediated by the atypical ubiquitin ligase UBE2O.
24697775 2014 Ocular melanoma and the BAP1 hereditary cancer syndrome: implications for the dermatologist.
24511587 2014 Uveal melanoma gene expression status post radiotherapy.
24382589 2014 Loss of BAP1 protein expression is an independent marker of poor prognosis in patients with low-risk clear cell renal cell carcinoma.
24373783 2014 Histopathologic clues for the diagnosis of Wiesner nevus.
24347639 2014 Tumor suppressor and deubiquitinase BAP1 promotes DNA double-strand break repair.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24247622 2013 BAP1 protein loss by immunohistochemistry: a potentially useful tool for prognostic prediction in patients with uveal melanoma.
24243779 2014 Expanding the clinical phenotype of hereditary BAP1 cancer predisposition syndrome, reporting three new cases.
24211834 2013 BAP1 is phosphorylated at serine 592 in S-phase following DNA damage.
24187051 2014 BAP1 germline mutation in two first grade family members with uveal melanoma.
24185509 2013 Exome sequencing identifies frequent inactivating mutations in BAP1, ARID1A and PBRM1 in intrahepatic cholangiocarcinomas.
24166983 2014 Clinical and pathological impact of VHL, PBRM1, BAP1, SETD2, KDM6A, and JARID1c in clear cell renal cell carcinoma.
24128712 2013 Clinical characteristics of patients with malignant pleural mesothelioma harboring somatic BAP1 mutations.
24076305 2014 BAP1 immunohistochemistry predicts outcomes in a multi-institutional cohort with clear cell renal cell carcinoma.
24029645 2014 Radiogenomics of clear cell renal cell carcinoma: associations between CT imaging features and mutations.
24018818 2013 BAP1 expression in cutaneous melanoma: a pilot study.
23977234 2013 A BAP1 mutation in a Danish family predisposes to uveal melanoma and other cancers.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23963927 2014 BAP1 protein is a progression factor in malignant pleural mesothelioma.
23915344 2013 BAP1 deficiency causes loss of melanocytic cell identity in uveal melanoma.
23867514 PBRM1 and BAP1 as novel targets for renal cell carcinoma.
23849051 2013 Further evidence for germline BAP1 mutations predisposing to melanoma and malignant mesothelioma.
23709298 2013 A novel germline mutation in BAP1 predisposes to familial clear-cell renal cell carcinoma.
23684012 2013 Germline BAP1 mutations predispose to renal cell carcinomas.
23644518 2013 Aberrant promoter hypermethylation of PBRM1, BAP1, SETD2, KDM6A and other chromatin-modifying genes is absent or rare in clear cell RCC.
23620406 2013 Adverse outcomes in clear cell renal cell carcinoma with mutations of 3p21 epigenetic regulators BAP1 and SETD2: a report by MSKCC and the KIRC TCGA research network.
23495950 2013 Clumped perinuclear BAP1 expression is a frequent finding in sporadic epithelioid Spitz tumors.
23341325 2013 Hereditary uveal melanoma: a report of a germline mutation in BAP1.
23333114 2013 Effects on survival of BAP1 and PBRM1 mutations in sporadic clear-cell renal-cell carcinoma: a retrospective analysis with independent validation.
23277170 2013 Tumours associated with BAP1 mutations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23171164 2013 Prevalence of germline BAP1 mutation in a population-based sample of uveal melanoma cases.
23147254 2013 The ASXL-BAP1 axis: new factors in myelopoiesis, cancer and epigenetics.
23032617 2012 Toward an improved definition of the tumor spectrum associated with BAP1 germline mutations.
23026932 2013 Combined BRAF(V600E)-positive melanocytic lesions with large epithelioid cells lacking BAP1 expression and conventional nevomelanocytes.
22958294 2012 Somatic mutation of a tumor suppressor gene BAP1 is rare in breast, prostate, gastric and colorectal cancers.
22935333 2012 BAP1 cancer syndrome: malignant mesothelioma, uveal and cutaneous melanoma, and MBAITs.
22897849 2012 ASXL1 mutations promote myeloid transformation through loss of PRC2-mediated gene repression.
22889334 2012 A cryptic BAP1 splice mutation in a family with uveal and cutaneous melanoma, and paraganglioma.
22878500 2012 Loss of the tumor suppressor BAP1 causes myeloid transformation.
22863556 2012 BAP1 is a good prognostic factor in advanced non-small cell lung cancer.
22834783 2012 Genetics of primary intraocular tumors.
22683710 2012 BAP1 loss defines a new class of renal cell carcinoma.
22545102 2012 Germline BAP1 inactivation is preferentially associated with metastatic ocular melanoma and cutaneous-ocular melanoma families.
22367297 2012 A distinct subset of atypical Spitz tumors is characterized by BRAF mutation and loss of BAP1 expression.
22321046 2012 Frequent inactivation of the BAP1 gene in epithelioid-type malignant mesothelioma.
22268848 2012 The genetics of uveal melanoma: an emerging framework for targeted therapy.
22042019 2012 Genetic determinants of uveal melanoma.
21941004 2011 Germline BAP1 mutation predisposes to uveal melanoma, lung adenocarcinoma, meningioma, and other cancers.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21874003 2011 Germline mutations in BAP1 predispose to melanocytic tumors.
21874000 2011 Germline BAP1 mutations predispose to malignant mesothelioma.
21642991 2011 The nuclear deubiquitinase BAP1 is commonly inactivated by somatic mutations and 3p21.1 losses in malignant pleural mesothelioma.
21484256 2011 An emerging model for BAP1's role in regulating cell cycle progression.
21051595 2010 Frequent mutation of BAP1 in metastasizing uveal melanomas.
20805357 2010 The ubiquitin carboxyl hydrolase BAP1 forms a ternary complex with YY1 and HCF-1 and is a critical regulator of gene expression.
20436459 2010 Histone H2A deubiquitinase activity of the Polycomb repressive complex PR-DUB.
20302916 2010 The potential role of ubiquitin c-terminal hydrolases in oncogenesis.
19950226 2010 Single nucleotide polymorphisms in miRNA binding sites and miRNA genes as breast/ovarian cancer risk modifiers in Jewish high-risk women.
19815555 2009 The deubiquitinating enzyme BAP1 regulates cell growth via interaction with HCF-1.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
19197335 2009 Genetic sequence variations of BRCA1-interacting genes AURKA, BAP1, BARD1 and DHX9 in French Canadian families with high risk of breast cancer.
19188440 2009 Association of C-terminal ubiquitin hydrolase BRCA1-associated protein 1 with cell cycle regulator host cell factor 1.
19117993 2009 BRCA1-associated protein 1 interferes with BRCA1/BARD1 RING heterodimer activity.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18757409 2008 BRCA1-associated protein-1 is a tumor suppressor that requires deubiquitinating activity and nuclear localization.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12800201 2003 Novel tumor antigens identified by autologous antibody screening of childhood medulloblastoma cDNA libraries.
12485996 2002 Activation of the E3 ligase function of the BRCA1/BARD1 complex by polyubiquitin chains.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10667217 1999 BAP1, a candidate tumor suppressor protein that interacts with BRCA1.
10546591 1999 Defining biochemical functions for the BRCA1 tumor suppressor protein: analysis of the BRCA1 binding protein BAP1.
9528852 1998 BAP1: a novel ubiquitin hydrolase which binds to the BRCA1 RING finger and enhances BRCA1-mediated cell growth suppression.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.