Property Summary

NCBI Gene PubMed Count 36
PubMed Score 50.20
PubTator Score 26.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Menopause present (finding) 20
Disease Target Count P-value
tuberculosis 1563 4.9e-09
ovarian cancer 8491 3.8e-05
psoriasis 6685 1.8e-04
osteosarcoma 7933 1.3e-03
Disease Target Count Z-score Confidence
Keratoconus 49 3.437 1.7
Disease Target Count
16q24.3 microdeletion syndrome 6

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.100 1.8e-04
osteosarcoma -1.017 1.3e-03
tuberculosis -1.600 4.9e-09
ovarian cancer 1.300 3.8e-05

Gene RIF (22)

PMID Text
26080397 results reveal the complex molecular mechanism underlying SMAR1-mediated signal-dependent and -independent regulation of alternative splicing via Sam68 deacetylation
25299772 SMAR1-mediated regulation of repair and apoptosis via a complex crosstalk involving Ku70, HDAC6 and Bax.
25239884 Data indicate the role of SMAR1 protein in NF-kappaappa B dependent transcriptional regulation of pro-angiogenic chemokine interleukin-8 (IL-8).
25157104 SMAR1 has a role in repressing c-Fos-mediated HPV18 E6 transcription through alteration of chromatin histone deacetylation
25086032 indicate a crucial role for SMAR1 in restraining breast cancer cell migration and suggest the candidature of this scaffold matrix-associated region-binding protein as a tumor suppressor.
23876508 During hemin-induced erythroid differentiation, enhanced expression of SMAR1 negatively correlates with miR-320a expression.
22674979 TCF-4, beta-catenin, and SMAR1 tether at the -143-nucleotide site on the HIV LTR to inhibit HIV promoter activity.
22074660 Results indicate that SMAR1 is an important player in p300-p53 regulated DNA damage signalling pathway and can exert its effect on apoptosis in a transcription independent manner.
20709157 multiple roles of nuclear matrix associated protein SMAR1 in regulating various cellular target genes involved in cell growth, apoptosis and tumorigenesis.(REVIEW)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20153327 report Prostaglandin A2 (PGA2) induced binding of HSP70 to a novel site on phi1 SMAR1 5' UTR which stabilizes the wild type transcript and leads to subsequent increase in SMAR1 protein levels.
20153010 SMAR1 recruits HDAC1-Sin3 corepressor complex to remodel chromatin structure at HIV-1 LTR. Overexpression of SMAR1 leads to reduction in LTR-mediated transcription in a Tat dependent and independent manner, resulting in a decreased virion production
20097305 A novel mechanism of regulation of oxidative stress by ATM through modulation of SMAR1-AKR1a4 complex, is proposed.
20075864 On mild DNA damage, SMAR1 selectively represses BAX and PUMA through binding to the MAR independently of inducing p53 deacetylation through HDAC1.
19799771 Human breast cancer tissue sections that showed reduced SMAR1 expression exhibited increased surface roughness.
19303885 Results highlight the role of SMAR1 in masking the active phosphorylation site of p53, enabling the deacetylation of p53 by HDAC1-MDM2 complex, thereby regulating the p53 transcriptional response during stress rescue.
18981184 tumor suppressor protein SMAR1 can modulate NF-kappaB transactivation and inhibit tumorigenesis by regulating NF-kappaB target genes
18822384 tumor suppressor SMAR1 downregulates Cytokeratin 8 gene expression by modulating p53-mediated transactivation of this gene
17668048 SMAR1 plays a central role in coordinating p53 and TGFbeta pathways in human breast cancer.
16166625 SMAR1 regulates cyclin D1 by modification of chromatin through the SIN3/histone deacetylase 1 complex
15623522 SMAR1 plays an important role in the regulation of T cell development as well as V(D)J recombination
10950932 Identification of a novel mouse MAR-binding protein, named SMAR1, which shares homology with SATB1 and Cux in the MAR-binding domain/Cut repeat and also with the tetramerization domain of a B cell-specific MAR-binding protein, Bright.

AA Sequence

MMSEHDLADVVQIAVEDLSPDHPVVLENHVVTDEDEPALKRQRLEINCQDPSIKTICLRLDSIEAKLQAL      1 - 70
EATCKSLEEKLDLVTNKQHSPIQVPMVAGSPLGATQTCNKVRCVVPQTTVILNNDRQNAIVAKMEDPLSN     71 - 140
RAPDSLENVISNAVPGRRQNTIVVKVPGQEDSHHEDGESGSEASDSVSSCGQAGSQSIGSNVTLITLNSE    141 - 210
EDYPNGTWLGDENNPEMRVRCAIIPSDMLHISTNCRTAEKMALTLLDYLFHREVQAVSNLSGQGKHGKKQ    211 - 280
LDPLTIYGIRCHLFYKFGITESDWYRIKQSIDSKCRTAWRRKQRGQSLAVKSFSRRTPNSSSYCPSEPMM    281 - 350
STPPPASELPQPQPQPQALHYALANAQQVQIHQIGEDGQVQVGHLHIAQVPQGEQVQITQDSEGNLQIHH    351 - 420
VGQDGQLLEATRIPCLLAPSVFKASSGQVLQGAQLIAVASSDPAAAGVDGSPLQGSDIQVQYVQLAPVSD    421 - 490
HTAGAQTAEALQPTLQPEMQLEHGAIQIQ                                             491 - 519
//

Text Mined References (41)

PMID Year Title
26080397 2015 Nuclear matrix-associated protein SMAR1 regulates alternative splicing via HDAC6-mediated deacetylation of Sam68.
25416956 2014 A proteome-scale map of the human interactome network.
25299772 2014 SMAR1 coordinates HDAC6-induced deacetylation of Ku70 and dictates cell fate upon irradiation.
25239884 2014 Chromatin remodeling protein SMAR1 regulates NF-?B dependent Interleukin-8 transcription in breast cancer.
25157104 2014 Nuclear matrix protein SMAR1 represses c-Fos-mediated HPV18 E6 transcription through alteration of chromatin histone deacetylation.
25086032 2014 Inhibition of epithelial to mesenchymal transition by E-cadherin up-regulation via repression of slug transcription and inhibition of E-cadherin degradation: dual role of scaffold/matrix attachment region-binding protein 1 (SMAR1) in breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23876508 2013 miR-320a regulates erythroid differentiation through MAR binding protein SMAR1.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22674979 2012 Identification of novel T cell factor 4 (TCF-4) binding sites on the HIV long terminal repeat which associate with TCF-4, ?-catenin, and SMAR1 to repress HIV transcription.
22074660 2012 Chromatin remodelling protein SMAR1 inhibits p53 dependent transactivation by regulating acetyl transferase p300.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20719862 2010 New loci associated with central cornea thickness include COL5A1, AKAP13 and AVGR8.
20709157 2011 Gene regulation by SMAR1: Role in cellular homeostasis and cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20153327 2010 Heat-shock protein 70 binds to a novel sequence in 5' UTR of tumor suppressor SMAR1 and regulates its mRNA stability upon Prostaglandin A2 treatment.
20097305 2010 SMAR1 regulates free radical stress through modulation of AKR1a4 enzyme activity.
20075864 2010 Coordinated regulation of p53 apoptotic targets BAX and PUMA by SMAR1 through an identical MAR element.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19799771 2009 Tumor suppressor protein SMAR1 modulates the roughness of cell surface: combined AFM and SEM study.
19448619 2009 Loci at chromosomes 13, 19 and 20 influence age at natural menopause.
19303885 2009 SMAR1 forms a ternary complex with p53-MDM2 and negatively regulates p53-mediated transcription.
18981184 2009 Tumor suppressor SMAR1 represses IkappaBalpha expression and inhibits p65 transactivation through matrix attachment regions.
18822384 2009 Tumor suppressor SMAR1 downregulates Cytokeratin 8 expression by displacing p53 from its cognate site.
17668048 2007 p53 target gene SMAR1 is dysregulated in breast cancer: its role in cancer cell migration and invasion.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16166625 2005 Tumor suppressor SMAR1 mediates cyclin D1 repression by recruitment of the SIN3/histone deacetylase 1 complex.
15701641 2005 Tumor suppressor SMAR1 activates and stabilizes p53 through its arginine-serine-rich motif.
15623522 2005 Abnormal V(D)J recombination of T cell receptor beta locus in SMAR1 transgenic mice.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15371550 2004 SMAR1 and Cux/CDP modulate chromatin and act as negative regulators of the TCRbeta enhancer (Ebeta).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12494467 2003 Direct interaction with and activation of p53 by SMAR1 retards cell-cycle progression at G2/M phase and delays tumor growth in mice.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10950932 2000 SMAR1, a novel, alternatively spliced gene product, binds the Scaffold/Matrix-associated region at the T cell receptor beta locus.
10940556 2000 Identification and molecular analysis of BANP.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.