Property Summary

NCBI Gene PubMed Count 41
PubMed Score 27.10
PubTator Score 39.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.560 3.1e-02
chronic lymphocytic leukemia -2.005 8.0e-04
urothelial carcinoma -1.800 2.2e-02
malignant mesothelioma -3.500 1.7e-08
cutaneous lupus erythematosus 2.200 3.3e-02
osteosarcoma -3.619 5.4e-07
tuberculosis and treatment for 3 months 1.300 2.9e-03
non-small cell lung cancer -1.369 9.6e-15
intraductal papillary-mucinous adenoma (... 3.000 3.1e-04
intraductal papillary-mucinous carcinoma... 1.500 1.7e-02
colon cancer -2.800 1.3e-02
lung cancer -2.600 7.4e-05
active Crohn's disease 1.702 2.8e-03
interstitial cystitis 1.500 4.2e-02
primary Sjogren syndrome 3.300 7.9e-06
nasopharyngeal carcinoma -2.300 4.7e-03
Endometriosis -1.791 5.7e-03
spina bifida -1.217 3.6e-02
ulcerative colitis 2.600 2.4e-03

Gene RIF (39)

PMID Text
25608828 Data show that single-nucleotide polymorphism rs3733197 located in the coding region of BANK1 (B-cell scaffold protein with ankyrin repeats 1) was significantly associated with serum LDL cholesterols.
24879116 Authors identified a novel balanced reciprocal translocation, t(4;14)(q24;q32.) Sequence analysis identified the partner gene as BANK1.
24342660 BANK1 and IL15 as new T1D genetic susceptibility factors.
24127308 Our findings suggest the existence of association between BANK1 gene and autoimmune thyroid diseases
24085759 Our study confirms evidence for epistasis between BLK and BANK1 in systemic lupus erythematosis from a Chinese population for the first time.
23899688 SNPs of the FAM167A-BLK region, but not the BANK1 SNPs, were associated with the development of primary Sjogren's syndrome in Han Chinese.
23646104 This study confirms BANK1 as an RA susceptibility gene and for the first time provides evidence for epistasis between BANK1 and BLK in RA.
23555801 BANK1 and BLK have roles in B-cell signaling through phospholipase C gamma 2
23065315 This study did not reveal a major role for BANK1 in humoral autoimmunity in chronic arthritis.
22003931 allelic variation in BANK1 does not play a major role in determining multifocal motor neuropathy susceptibility.
21989138 Polymorphism in BANK1 is associated with susceptibility to psoriasis in Southern Han Chinese.
21978998 This study shows a genetic interaction between BANK1 and BLK, and demonstrates that these molecules interact physically.
21900951 short Delta2 isoform of BANK1 displays a homogeneous cytoplasmic distribution
21208380 This meta-analysis demonstrates a significant association between BANK1 and TNFAIP3 gene polymorphism and systemic lupus erythematosus in multiple ethnic populations.
21078628 This study implies that rs10516487 and rs17266594 polymorphisms might contribute to individual susceptibility to SLE
21078628 Observational study of gene-disease association. (HuGE Navigator)
21068098 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20962850 Observational study of gene-disease association. (HuGE Navigator)
20881011 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20848568 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20472928 Results do not support a major implication of the BANK1 locus in susceptibility to giant cell arteritis.
20472928 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20131273 Observational study of gene-disease association. (HuGE Navigator)
19877059 BANK1 is a new systemic sclerosis genetic susceptibility factor. BANK1, IRF5, and STAT4 act with additive effects.
19877059 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19815934 results suggest that the BANK1 gene confers susceptibility to systemic sclerosis in general, and specifically to the diffuse cutanenous systemic sclerosis and anti-topoisomerase I antibody subsets.
19815934 Observational study of gene-disease association. (HuGE Navigator)
19644876 STAT4 and BLK displayed a strong genetic association with primary antiphospholipid syndrome, while a weak association with IRF5 and no association with BANK1 were observed.
19644876 Observational study of gene-disease association. (HuGE Navigator)
19357697 Study confirmed the associations of BANK1 (rs3733197)and TNFSF4 (rs844648) with systemic lupus erythematosus in Hong Kong Chinese.
19357697 Observational study of gene-disease association. (HuGE Navigator)
19339986 Study independently replicates and confirms the strong association of BANK1 variants rs17266594 and rs10516487 with the risk of systemic lupus erythematosus in the European-derived population.
19339986 Observational study of gene-disease association. (HuGE Navigator)
19180476 These results suggest that BANK1 SNPs and haplotypes may contribute to rheumatoid arthritis susceptibility with a low risk.
19180476 Observational study of gene-disease association. (HuGE Navigator)
19110536 Observational study of gene-disease association. (HuGE Navigator)
18204447 Genome-wide association study of gene-disease association. (HuGE Navigator)
18204447 Functional variants in the B-cell gene BANK1 are assoicated with systemic lupus erythematosus.

AA Sequence

MLPAAPGKGLGSPDPAPCGPAPPGNTKDIIMIYEEDAEEWALYLTEVFLHVVKREAILLYRLENFSFRHL      1 - 70
ELLNLTSYKCKLLILSNSLLRDLTPKKCQFLEKILHSPKSVVTLLCGVKSSDQLYELLNISQSRWEISTE     71 - 140
QEPEDYISVIQSIIFKDSEDYFEVNIPTDLRAKHSGEISERKEIEELSEASRNTIPLAVVLPTEIPCENP    141 - 210
GEIFIILRDEVIGDTVEVEFTSSNKRIRTRPALWNKKVWCMKALEFPAGSVHVNVYCDGIVKATTKIKYY    211 - 280
PTAKAKECLFRMADSGESLCQNSIEELDGVLTSIFKHEIPYYEFQSLQTEICSQNKYTHFKELPTLLHCA    281 - 350
AKFGLKNLAIHLLQCSGATWASKMKNMEGSDPAHIAERHGHKELKKIFEDFSIQEIDINNEQENDYEEDI    351 - 420
ASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPLEVGSESSEDQYDDLYVF    421 - 490
IPGADPENNSQEPLMSSRPPLPPPRPVANAFQLERPHFTLPGTMVEGQMERSQNWGHPGVRQETGDEPKG    491 - 560
EKEKKEEEKEQEEEEDPYTFAEIDDSEYDMILANLSIKKKTGSRSFIINRPPAPTPRPTSIPPKEETTPY    561 - 630
IAQVFQQKTARRQSDDDKFCGLPKKQDRARIESPAFSTLRGCLTDGQEELILLQEKVKNGKMSMDEALEK    631 - 700
FKHWQMGKSGLEMIQQEKLRQLRDCIIGKRPEEENVYNKLTIVHHPGGKETAHNENKFYNVHFSNKLPAR    701 - 770
PQVEKEFGFCCKKDH                                                           771 - 785
//

Text Mined References (43)

PMID Year Title
25608828 2015 A nonsynonymous SNP in BANK1 is associated with serum LDL cholesterol levels in three Korean populations.
24879116 2014 Inactivation of BANK1 in a novel IGH-associated translocation t(4;14)(q24;q32) suggests a tumor suppressor role in B-cell lymphoma.
24342660 2014 Association of BANK1 and cytokine gene polymorphisms with type 1 diabetes in Tunisia.
24127308 2013 Genetic variants of BANK1 gene in autoimmune thyroid diseases: a case-control association study.
24085759 2013 Genetic interactions between BANK1 and BLK in Chinese patients with systemic lupus erythematosus.
23899688 Polymorphisms in the FAM167A-BLK, but not BANK1, are associated with primary Sjögren's syndrome in a Han Chinese population.
23646104 2013 Epistatic interaction between BANK1 and BLK in rheumatoid arthritis: results from a large trans-ethnic meta-analysis.
23555801 2013 BANK1 and BLK act through phospholipase C gamma 2 in B-cell signaling.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23065315 2013 Altered BANK1 expression is not associated with humoral autoimmunity in chronic joint inflammation.
22763476 2012 Genome-wide linkage and association scans for pulse pressure in Chinese twins.
22003931 2011 Multifocal motor neuropathy is not associated with genetic variation in PTPN22, BANK1, Blk, FCGR2B, CD1A/E, and TAG-1 genes.
21989138 2011 Association analysis of BANK1 gene with psoriasis in Southern Han Chinese.
21978998 2012 Genetic and physical interaction of the B-cell systemic lupus erythematosus-associated genes BANK1 and BLK.
21900951 2012 The dual effect of the lupus-associated polymorphism rs10516487 on BANK1 gene expression and protein localization.
21480188 2011 C8orf13-BLK is a genetic risk locus for systemic sclerosis and has additive effects with BANK1: results from a large french cohort and meta-analysis.
21208380 2011 The association between BANK1 and TNFAIP3 gene polymorphisms and systemic lupus erythematosus: a meta-analysis.
21078628 2011 Identification of BANK1 polymorphisms by unlabelled probe high resolution melting: association with systemic lupus erythematosus susceptibility and autoantibody production in Han Chinese.
21068098 2011 Study of the common genetic background for rheumatoid arthritis and systemic lupus erythematosus.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20881011 2011 Early disease onset is predicted by a higher genetic risk for lupus and is associated with a more severe phenotype in lupus patients.
20848568 2010 Genetically determined Amerindian ancestry correlates with increased frequency of risk alleles for systemic lupus erythematosus.
20472928 2010 Role of BANK1 gene polymorphisms in biopsy-proven giant cell arteritis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20131273 2010 IRF5 is associated with primary antiphospholipid syndrome, but is not a major risk factor.
19877059 2009 BANK1 is a genetic risk factor for diffuse cutaneous systemic sclerosis and has additive effects with IRF5 and STAT4.
19815934 2010 BANK1 functional variants are associated with susceptibility to diffuse systemic sclerosis in Caucasians.
19644876 2009 Association of STAT4 and BLK, but not BANK1 or IRF5, with primary antiphospholipid syndrome.
19357697 2009 Association of BANK1 and TNFSF4 with systemic lupus erythematosus in Hong Kong Chinese.
19339986 2009 Replication of the BANK1 genetic association with systemic lupus erythematosus in a European-derived population.
19180476 2009 Study of functional variants of the BANK1 gene in rheumatoid arthritis.
19110536 2009 Analysis of 17 autoimmune disease-associated variants in type 1 diabetes identifies 6q23/TNFAIP3 as a susceptibility locus.
18204447 2008 Functional variants in the B-cell gene BANK1 are associated with systemic lupus erythematosus.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11782428 2002 BANK regulates BCR-induced calcium mobilization by promoting tyrosine phosphorylation of IP(3) receptor.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.