Property Summary

NCBI Gene PubMed Count 67
PubMed Score 667.71
PubTator Score 270.88

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (51)

PMID Text
26842478 antiviral capabilities of the barrier to autointegration factor (BAF/BANF1) and how its function and regulation places BAF at the junction of multiple pathways protecting a cell's genetic integrity
26223647 Vaccinia virus B1 kinase is needed for multiple critical junctures in the poxviral life cycle in a manner that is both dependent on and independent of BAF.
26092935 The findings unveil a unique mechanism where the nuclear periphery proteins lamin-A/C, LAP2alpha and BAF1 are assembled into a protein complex during mitosis in order to regulate assembly and positioning of the mitotic spindle.
26015494 results demonstrate a novel function of BAF as an epigenetic regulator of HSV lytic infection; hypothesize that BAF facilitates Herpes Simplex Virus IE and E gene expression by recruiting the SETD1A methyltransferase to viral IE and E gene promoters
25991860 BAF is a cytosolic DNA sensor that leads to exogenous DNA avoiding autophagy.
25899223 These data suggest that VRK3-mediated phosphorylation of BAF may facilitate DNA replication or gene expression by facilitating the dissociation of nuclear envelope proteins and chromatin during interphase.
25495845 The BANF1, alanine 12 threonine (A12T) mutant is impaired in its ability to bind DNA while its interaction with nuclear envelope proteins is unperturbed.
25052089 Association of emerin with nuclear BAF in cells required the LEM domain (residues 1-47).
24600006 Altogether, these data demonstrate that phosphoregulation of BAF by viral and cellular enzymes modulates this protein at multiple molecular levels, thus determining its effectiveness as an antiviral factor and likely other functions as well.
24430874 VRK1 deficiency disrupts nuclear envelope morphology and leads to BAF retention on mitotic chromosomes.
24265311 Data indicate that the major phosphatase responsible for dephosphorylation of of BAF Ser-4 to be protein phosphatase 4 catalytic subunit.
24014020 Emerin and BAF associated only in histone- and lamin-B-containing fractions. The S173D mutation specifically and selectively reduced GFP-emerin association with BAF by 58%
23891157 The decrease in vaccinia virus transcription caused by loss of B1 kinase can be rescued by depletion of BAF.
23664529 Activation of BANF1 possibly suppresses S100A9 expression and inactivates c-Jun, resulting in suppression of cutaneous inflammation
23024700 Barrier-to-autointegration factor (BAF) is required for the association of viral cDNA with emerin and for chromatin engagement by viral cDNA before integration, indicating potential interactions between BAF, emerin and HIV-1 integrase
22935701 The accumulation of wild-type prelamin A detected in restrictive dermopathy as well as the accumulation of mutated forms identified in familial partial lipodystrophy and mandibuloacral dysplasia affect the nuclear localization of BAF protein.
22127260 BAF associated in vivo with SET/I2PP2A (protein phosphatase 2A inhibitor; blocks H3 dephosphorylation) and G9a (H3-K9 methyltransferase), but showed no detectable association with HDAC1 or HATs.
21966431 The absence of direct binding of BAF to MAN1-C eliminates disruption of this interaction as the cause of the premature aging phenotype.
21966431 Barrier-to-autointegration factor (BAF) is required for the association of viral cDNA with emerin and for chromatin engagement by viral cDNA before integration, indicating potential interactions between BAF, emerin and HIV-1 integrase
21932319 A single copy of normal BANF1 is sufficient to avoid the development of Nestor-Guillermo progeria syndrome.
21880762 The authors demonstrate that the DNA binding and dimerization capabilities of BAF are essential for its function as an antipoxviral effector, while the presence of emerin is not required.
21750191 Data determined that the knockdown of Banf1 alters the cell cycle distribution of both human and mouse ESCs by causing an uncharacteristic increase in the proportion of cells in the G2-M phase of the cell cycle.
21549337 These nuclear abnormalities are rescued by ectopic expression of wild-type BANF1, providing evidence for the causal role of this mutation.
21447625 Cooperation of ATP-dependent remodeling, histone methylation, and kinase activation, followed by H1 displacement, is a prerequisite for the subsequent displacement of histone H2A/H2B catalyzed by PCAF and BAF.
20581439 These findings are supported by coimmunoprecipitation of prelamin A or progerin with BAF in vivo and suggest that BAF could mediate prelamin A-induced chromatin effects.
19759913 BAF and emerin have dynamic roles in genome integrity and might help couple DNA damage responses to the nuclear lamina network
19750561 Barrier-to-autointegration factor (BAF) is required for the association of viral cDNA with emerin and for chromatin engagement by viral cDNA before integration, indicating potential interactions between BAF, emerin and HIV-1 integrase
18628300 analyses in human cells showed that barrier-to-autointegration factor (BAF), assembled first at the distinct ;core' region of the telophase chromosome and formed an immobile complex by binding with NE proteins, such as lamin A and emerin.
18005698 We now show that BAF acts as a potent inhibitor of poxvirus replication unless its DNA-binding activity is blocked by B1-mediated phosphorylation.
17519288 These results indicate that barrier-to-autointegration factor is required for the integrity of the nuclear lamina and normal progression of S phase in human cells.
17304248 Barrier-to-autointegration factor (BAF) is required for the association of viral cDNA with emerin and for chromatin engagement by viral cDNA before integration, indicating potential interactions between BAF, emerin and HIV-1 integrase
16738646 Barrier-to-autointegration factor (BAF) is required for the association of viral cDNA with emerin and for chromatin engagement by viral cDNA before integration, indicating potential interactions between BAF, emerin and HIV-1 integrase
16680152 Barrier-to-autointegration factor (BAF) is required for the association of viral cDNA with emerin and for chromatin engagement by viral cDNA before integration, indicating potential interactions between BAF, emerin and HIV-1 integrase
16403635 Barrier-to-autointegration factor (BAF) is required for the association of viral cDNA with emerin and for chromatin engagement by viral cDNA before integration, indicating potential interactions between BAF, emerin and HIV-1 integrase
16371512 Ser-4 phosphorylation inhibits BAF binding to emerin and lamin A, and thereby weakens emerin-lamin interactions during both mitosis and interphase.
16204256 phosphorylation at Ser175 regulates the dissociation of emerin from BAF
16155580 BAF bridges DNA using two pairs of helix-hairpin-helix motifs located on opposite surfaces of the BAF dimer without changing its conformation.
16075307 Barrier-to-autointegration factor (BAF) is required for the association of viral cDNA with emerin and for chromatin engagement by viral cDNA before integration, indicating potential interactions between BAF, emerin and HIV-1 integrase
15875659 Barrier-to-autointegration factor (BAF) is required for the association of viral cDNA with emerin and for chromatin engagement by viral cDNA before integration, indicating potential interactions between BAF, emerin and HIV-1 integrase
15546916 LAP2alpha and BAF transiently localize to telomeres and specific regions on chromatin during nuclear assembly
15109603 Data describe the mobility of barrier-to-autointegration factor to its partners emerin, LAP2 beta, and MAN1 in the nuclear membrane of living HeLa cells.
14645565 BAF protein was detected in activated but not resting CD4+ T-lymphocytes. BAF bound directly to both p55 Gag and its cleaved product, matrix.
14645565 Barrier-to-autointegration factor (BAF) is required for the association of viral cDNA with emerin and for chromatin engagement by viral cDNA before integration, indicating potential interactions between BAF, emerin and HIV-1 integrase
14523012 HB and barrier-to-autointegration factor are the same protein
12663813 report that BAF protein is a component of preintegration complexes isolated from HIV-1-infected cells
12663813 Barrier-to-autointegration factor (BAF) is required for the association of viral cDNA with emerin and for chromatin engagement by viral cDNA before integration, indicating potential interactions between BAF, emerin and HIV-1 integrase
12493765 BAF may have a role in regulating emerin-GCL repressor complexes
11792822 BAF is required for the assembly of emerin and A-type lamins at the reforming nuclear envelope during telophase and may mediate their stability in the subsequent interphase.
11792821 The barrier-to-autointegration factor (BAF)-binding domain of emerin is located at the emerin N-terminus (residues 70-178) and includes the LEM-domain.
9465049 Barrier-to-autointegration factor (BAF) is required for the association of viral cDNA with emerin and for chromatin engagement by viral cDNA before integration, indicating potential interactions between BAF, emerin and HIV-1 integrase
7937898 Barrier-to-autointegration factor (BAF) is required for the association of viral cDNA with emerin and for chromatin engagement by viral cDNA before integration, indicating potential interactions between BAF, emerin and HIV-1 integrase

AA Sequence

MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGAN      1 - 70
AKQSRDCFGCLREWCDAFL                                                        71 - 89
//

Text Mined References (74)

PMID Year Title
26842478 2016 The Barrier to Autointegration Factor: Interlocking Antiviral Defense with Genome Maintenance.
26223647 2015 Vaccinia Virus B1 Kinase Is Required for Postreplicative Stages of the Viral Life Cycle in a BAF-Independent Manner in U2OS Cells.
26092935 2015 The lamin-A/C-LAP2?-BAF1 protein complex regulates mitotic spindle assembly and positioning.
26015494 2015 Barrier-to-Autointegration Factor 1 (BAF/BANF1) Promotes Association of the SETD1A Histone Methyltransferase with Herpes Simplex Virus Immediate-Early Gene Promoters.
25991860 2015 BAF is a cytosolic DNA sensor that leads to exogenous DNA avoiding autophagy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25899223 2015 Presumed pseudokinase VRK3 functions as a BAF kinase.
25495845 2014 Néstor-Guillermo Progeria Syndrome: a biochemical insight into Barrier-to-Autointegration Factor 1, alanine 12 threonine mutation.
25052089 2014 The molecular basis of emerin-emerin and emerin-BAF interactions.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24600006 2014 Cell- and virus-mediated regulation of the barrier-to-autointegration factor's phosphorylation state controls its DNA binding, dimerization, subcellular localization, and antipoxviral activity.
24430874 2014 Depletion of the protein kinase VRK1 disrupts nuclear envelope morphology and leads to BAF retention on mitotic chromosomes.
24265311 2014 Dephosphorylation of barrier-to-autointegration factor by protein phosphatase 4 and its role in cell mitosis.
24014020 2013 O-Linked ?-N-acetylglucosamine (O-GlcNAc) regulates emerin binding to barrier to autointegration factor (BAF) in a chromatin- and lamin B-enriched "niche".
23891157 2013 Barrier to autointegration factor (BAF) inhibits vaccinia virus intermediate transcription in the absence of the viral B1 kinase.
23664529 2013 Possible roles of barrier-to-autointegration factor 1 in regulation of keratinocyte differentiation and proliferation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22935701 2012 Familial partial lipodystrophy, mandibuloacral dysplasia and restrictive dermopathy feature barrier-to-autointegration factor (BAF) nuclear redistribution.
22770216 2012 Coordination of kinase and phosphatase activities by Lem4 enables nuclear envelope reassembly during mitosis.
22399800 2012 The endonuclease Ankle1 requires its LEM and GIY-YIG motifs for DNA cleavage in vivo.
22194607 2012 Macro histone H2A1.2 (macroH2A1) protein suppresses mitotic kinase VRK1 during interphase.
22127260 Barrier-to-Autointegration Factor influences specific histone modifications.
21966431 2011 No interaction of barrier-to-autointegration factor (BAF) with HIV-1 MA, cone-rod homeobox (Crx) or MAN1-C in absence of DNA.
21932319 2011 Néstor-Guillermo progeria syndrome: a novel premature aging condition with early onset and chronic development caused by BANF1 mutations.
21880762 2011 Molecular characterization of the host defense activity of the barrier to autointegration factor against vaccinia virus.
21750191 2011 Banf1 is required to maintain the self-renewal of both mouse and human embryonic stem cells.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21549337 2011 Exome sequencing and functional analysis identifies BANF1 mutation as the cause of a hereditary progeroid syndrome.
21447625 2011 Four enzymes cooperate to displace histone H1 during the first minute of hormonal gene activation.
21269460 2011 Initial characterization of the human central proteome.
20581439 2010 Lamin A precursor induces barrier-to-autointegration factor nuclear localization.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19759913 2009 Barrier-to-autointegration factor proteome reveals chromatin-regulatory partners.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18628300 2008 Live cell imaging and electron microscopy reveal dynamic processes of BAF-directed nuclear envelope assembly.
18005698 2007 Poxviral B1 kinase overcomes barrier to autointegration factor, a host defense against virus replication.
17519288 2007 Nuclear localization of barrier-to-autointegration factor is correlated with progression of S phase in human cells.
16680152 2006 The inner-nuclear-envelope protein emerin regulates HIV-1 infectivity.
16495336 2006 The vaccinia-related kinases phosphorylate the N' terminus of BAF, regulating its interaction with DNA and its retention in the nucleus.
16371512 2006 Barrier-to-autointegration factor phosphorylation on Ser-4 regulates emerin binding to lamin A in vitro and emerin localization in vivo.
16337940 2006 Barrier-to-autointegration factor-like (BAF-L): a proposed regulator of BAF.
16291214 2005 Retroviral DNA integration--mechanism and consequences.
16204256 2005 Dissociation of emerin from barrier-to-autointegration factor is regulated through mitotic phosphorylation of emerin in a xenopus egg cell-free system.
16203725 2005 Binding of barrier to autointegration factor (BAF) to histone H3 and selected linker histones including H1.1.
16155580 2005 Structural basis for DNA bridging by barrier-to-autointegration factor.
15681850 2005 Direct binding of nuclear membrane protein MAN1 to emerin in vitro and two modes of binding to barrier-to-autointegration factor.
15635413 2005 Nucleolar proteome dynamics.
15546916 2004 LAP2alpha and BAF transiently localize to telomeres and specific regions on chromatin during nuclear assembly.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479846 2004 APOBEC3G incorporation into human immunodeficiency virus type 1 particles.
15130582 2004 BAF: roles in chromatin, nuclear structure and retrovirus integration.
15109603 2004 Dynamic interaction between BAF and emerin revealed by FRAP, FLIP, and FRET analyses in living HeLa cells.
14645565 2003 Barrier-to-autointegration factor BAF binds p55 Gag and matrix and is a host component of human immunodeficiency virus type 1 virions.
14523012 2003 Identification of the autoantigen HB as the barrier-to-autointegration factor.
12663813 2003 The barrier-to-autointegration factor is a component of functional human immunodeficiency virus type 1 preintegration complexes.
12493765 2003 Transcriptional repressor germ cell-less (GCL) and barrier to autointegration factor (BAF) compete for binding to emerin in vitro.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12228227 2002 Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1.
12163470 2002 Barrier-to-autointegration factor: major roles in chromatin decondensation and nuclear assembly.
12163176 2002 Nesprin-1alpha self-associates and binds directly to emerin and lamin A in vitro.
12091904 2002 Charting HIV's remarkable voyage through the cell: Basic science as a passport to future therapy.
11792822 2001 BAF is required for emerin assembly into the reforming nuclear envelope.
11792821 2001 Distinct functional domains in emerin bind lamin A and DNA-bridging protein BAF.
11005805 2000 Both the structure and DNA binding function of the barrier-to-autointegration factor contribute to reconstitution of HIV type 1 integration in vitro.
10924106 2000 Structural basis of DNA bridging by barrier-to-autointegration factor.
10908652 2000 Barrier-to-autointegration factor (BAF) bridges DNA in a discrete, higher-order nucleoprotein complex.
10651245 1999 The nuclear lamina: molecular organization and interaction with chromatin.
10393804 1999 LAP2 binding protein 1 (L2BP1/BAF) is a candidate mediator of LAP2-chromatin interaction.
9783751 1998 Solution structure of the cellular factor BAF responsible for protecting retroviral DNA from autointegration.
9740667 1998 Genomic and functional map of the chromosome 14 t(12;14) breakpoint cluster region in uterine leiomyoma.
9521877 1998 A high-resolution metric HAPPY map of human chromosome 14.
9465049 1998 A previously unidentified host protein protects retroviral DNA from autointegration.
7937898 1994 Protection of retroviral DNA from autointegration: involvement of a cellular factor.