Property Summary

NCBI Gene PubMed Count 71
PubMed Score 741.36
PubTator Score 270.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
NESTOR-GUILLERMO PROGERIA SYNDROME 1 0.0 0.0

Expression

Gene RIF (54)

AA Sequence

MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGAN      1 - 70
AKQSRDCFGCLREWCDAFL                                                        71 - 89
//

Text Mined References (78)

PMID Year Title