Tbio | BMP and activin membrane-bound inhibitor homolog |
Negatively regulates TGF-beta signaling.
This gene encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encoded protein however is a pseudoreceptor, lacking an intracellular serine/threonine kinase domain required for signaling. Similar proteins in frog, mouse and zebrafish function as negative regulators of TGF-beta, which has led to the suggestion that the encoded protein may function to limit the signaling range of the TGF-beta family during early embryogenesis. [provided by RefSeq, Jul 2008]
This gene encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encoded protein however is a pseudoreceptor, lacking an intracellular serine/threonine kinase domain required for signaling. Similar proteins in frog, mouse and zebrafish function as negative regulators of TGF-beta, which has led to the suggestion that the encoded protein may function to limit the signaling range of the TGF-beta family during early embryogenesis. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
lung carcinoma | 2843 | 1.2e-45 |
ovarian cancer | 8520 | 3.3e-12 |
Astrocytoma, Pilocytic | 3081 | 8.9e-09 |
malignant mesothelioma | 3232 | 6.4e-07 |
cystic fibrosis | 1696 | 1.1e-06 |
psoriasis | 6694 | 5.5e-06 |
group 4 medulloblastoma | 1855 | 1.4e-05 |
colon cancer | 1478 | 1.3e-04 |
lung cancer | 4740 | 1.4e-04 |
invasive ductal carcinoma | 2951 | 5.9e-04 |
interstitial cystitis | 2312 | 6.0e-04 |
intraductal papillary-mucinous adenoma (IPMA) | 2955 | 1.2e-02 |
glioblastoma | 5792 | 1.7e-02 |
ductal carcinoma in situ | 1745 | 2.2e-02 |
aldosterone-producing adenoma | 665 | 4.1e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Meningitis | 67 | 4.777 | 2.4 |
Disease | log2 FC | p |
---|---|---|
aldosterone-producing adenoma | -1.378 | 4.1e-02 |
Astrocytoma, Pilocytic | 2.800 | 8.9e-09 |
colon cancer | 2.900 | 1.3e-04 |
cystic fibrosis | -1.627 | 1.1e-06 |
ductal carcinoma in situ | 2.200 | 2.2e-02 |
glioblastoma | 1.300 | 1.7e-02 |
group 4 medulloblastoma | -1.600 | 1.4e-05 |
interstitial cystitis | -1.800 | 6.0e-04 |
intraductal papillary-mucinous adenoma (... | -1.400 | 1.2e-02 |
invasive ductal carcinoma | 3.500 | 5.9e-04 |
lung cancer | 3.100 | 1.4e-04 |
lung carcinoma | 3.300 | 1.2e-45 |
malignant mesothelioma | -1.400 | 6.4e-07 |
ovarian cancer | -3.100 | 3.3e-12 |
psoriasis | -1.200 | 5.5e-06 |
Accession | Q13145 |
Symbols |
NMA |
Species | Source | Disease |
---|---|---|
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG |
MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCL 1 - 70 DSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQ 71 - 140 ELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAK 141 - 210 LDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV 211 - 260 //