| Tbio | BMP and activin membrane-bound inhibitor homolog |
Negatively regulates TGF-beta signaling.
This gene encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encoded protein however is a pseudoreceptor, lacking an intracellular serine/threonine kinase domain required for signaling. Similar proteins in frog, mouse and zebrafish function as negative regulators of TGF-beta, which has led to the suggestion that the encoded protein may function to limit the signaling range of the TGF-beta family during early embryogenesis. [provided by RefSeq, Jul 2008]
This gene encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encoded protein however is a pseudoreceptor, lacking an intracellular serine/threonine kinase domain required for signaling. Similar proteins in frog, mouse and zebrafish function as negative regulators of TGF-beta, which has led to the suggestion that the encoded protein may function to limit the signaling range of the TGF-beta family during early embryogenesis. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| lung carcinoma | 2844 | 1.2e-45 |
| ovarian cancer | 8491 | 3.3e-12 |
| pilocytic astrocytoma | 3086 | 1.2e-08 |
| malignant mesothelioma | 3163 | 6.4e-07 |
| cystic fibrosis | 1670 | 1.1e-06 |
| lung cancer | 4473 | 2.2e-06 |
| psoriasis | 6685 | 5.5e-06 |
| interstitial cystitis | 2299 | 1.0e-05 |
| group 4 medulloblastoma | 1875 | 1.4e-05 |
| colon cancer | 1475 | 1.3e-04 |
| invasive ductal carcinoma | 2950 | 5.9e-04 |
| intraductal papillary-mucinous adenoma (IPMA) | 2956 | 1.2e-02 |
| glioblastoma | 5572 | 1.7e-02 |
| ductal carcinoma in situ | 1745 | 2.2e-02 |
| aldosterone-producing adenoma | 664 | 4.1e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Meningitis | 46 | 4.584 | 2.3 |
| Simpson-Golabi-Behmel syndrome | 17 | 3.065 | 1.5 |
| Disease | log2 FC | p |
|---|---|---|
| malignant mesothelioma | -1.400 | 6.4e-07 |
| psoriasis | -1.200 | 5.5e-06 |
| glioblastoma | 1.300 | 1.7e-02 |
| cystic fibrosis | -1.627 | 1.1e-06 |
| group 4 medulloblastoma | -1.600 | 1.4e-05 |
| intraductal papillary-mucinous adenoma (... | -1.400 | 1.2e-02 |
| lung cancer | 3.300 | 2.2e-06 |
| colon cancer | 2.900 | 1.3e-04 |
| interstitial cystitis | -2.100 | 1.0e-05 |
| pilocytic astrocytoma | 2.800 | 1.2e-08 |
| aldosterone-producing adenoma | -1.378 | 4.1e-02 |
| lung carcinoma | 3.300 | 1.2e-45 |
| ductal carcinoma in situ | 2.200 | 2.2e-02 |
| invasive ductal carcinoma | 3.500 | 5.9e-04 |
| ovarian cancer | -3.100 | 3.3e-12 |
| PMID | Text | |
|---|---|---|
| 26258650 | TGFbeta target genes including TGFBI, BAMBI, COL3A1 and SERPINE1 are significantly increased in Diamond Blackfan Anemia induced pluripotent stem cells | |
| 24912656 | betacatenin expression was downregulated as a result of knocking down of BAMBI, and TGF-beta was downregulated in a similar manner. | |
| 24798646 | The observations illuminated that BAMBI inhibits adipogenesis by a feedback loop (BAMBI-->beta-catenin nuclear translocation-->BAMBI), which forms with Wnt/beta-catenin signaling. | |
| 24752577 | BAMBI alone or in combination with Smad7 was significantly associated with the OS and DFS. These findings suggest that BAMBI and Smad7 may cooperatively inhibit the TGF-beta signaling, and thus promote the progression of gastric cancer. | |
| 24448807 | study demonstrates that LPS- and TNF-alpha-induced NF-kappaBp50-HDAC1 interaction represses BAMBI transcriptional activity, which contributes to TLR4-mediated enhancement of TGF-beta signaling in hepatic stellate cells during liver fibrosis. | |
| 23807684 | Overexpression of BAMBI is associated with the growth and invasion of human osteosarcoma. | |
| 22406377 | Metformin-mediated Bambi expression in hepatic stellate cells induces prosurvival Wnt/beta-catenin signaling | |
| 22187378 | Alterations in BAMBI may play a role in the (patho)physiology of obesity, and manipulation of BAMBI may present a novel therapeutic approach to improve adipose tissue function. | |
| 21496456 | Data show that hepatoprotective effects of adiponectin include induction of BAMBI which is reduced in human fatty liver. | |
| 20886049 | BAMBI protein is expressed in endothelial cells and is regulated by autophagy and lysosomal degradation. | |
| 20634891 | Observational study of gene-disease association. (HuGE Navigator) | |
| 20513241 | Expression of the TGF pseudoreceptor BAMBI in the human lung, which is upregulated in response to nontypeable Haemophilus influenzae infection in COPD lung tissue in vivo and in vitro. | |
| 20189233 | Authors demonstrate for the first time a nuclear co-translocation of BAMBI with Smad2/3 upon TGF-geta treatment. Moreover, overexpression of BAMBI in an in vitro model led to significantly increased proliferation. | |
| 19998449 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19758997 | Mechanistically, in addition to interfering with the complex formation between the type I and type II receptors, hBAMBI cooperates with Smad7 to inhibit TGF-beta signaling | |
| 19328798 | A colorectal cancer expression profile that includes transforming growth factor beta inhibitor BAMBI predicts metastatic potential. | |
| 19326429 | hypermethylation of the BAMBI gene promoter that leads to BAMBI gene suppression may be one of the epigenetic events affecting the invasiveness or aggressiveness of bladder cancers | |
| 18838381 | BAMBI interacts with Wnt receptor Frizzled5, coreceptor LRP6, and Dishevelled2 and increases the interaction between Frizzled5 and Dishevelled2 | |
| 18756595 | BAMBI was linked to a potentially aggressive tumor phenotype and predicted tumor recurrence and cancer-related death in CRC. | |
| 15240101 | Our findings suggest that BAMBI transcription is regulated by TGF-beta signaling through direct binding of SMAD3 and SMAD4 to the BAMBI promoter. | |
| 14660579 | beta-catenin interferes with transforming growth factor-beta-mediated growth arrest by inducing the expression of BAMBI |
MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCL 1 - 70 DSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQ 71 - 140 ELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAK 141 - 210 LDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV 211 - 260 //
| PMID | Year | Title | |
|---|---|---|---|
| 26258650 | 2015 | Dysregulation of the Transforming Growth Factor ? Pathway in Induced Pluripotent Stem Cells Generated from Patients with Diamond Blackfan Anemia. | |
| 24912656 | 2014 | Knockdown of BAMBI inhibits ?-catenin and transforming growth factor ? to suppress metastasis of gastric cancer cells. | |
| 24798646 | 2014 | BMP and activin membrane-bound inhibitor (BAMBI) inhibits the adipogenesis of porcine preadipocytes through Wnt/?-catenin signaling pathway. | |
| 24752577 | 2014 | Expression of BAMBI and its combination with Smad7 correlates with tumor invasion and poor prognosis in gastric cancer. | |
| 24448807 | 2014 | Transcriptional repression of the transforming growth factor ? (TGF-?) Pseudoreceptor BMP and activin membrane-bound inhibitor (BAMBI) by Nuclear Factor ?B (NF-?B) p50 enhances TGF-? signaling in hepatic stellate cells. | |
| 23807684 | 2013 | The overexpression of BAMBI and its involvement in the growth and invasion of human osteosarcoma cells. | |
| 23551011 | 2013 | Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort. | |
| 22406377 | 2012 | Metformin-mediated Bambi expression in hepatic stellate cells induces prosurvival Wnt/?-catenin signaling. | |
| 22187378 | 2012 | Identification of BMP and activin membrane-bound inhibitor (BAMBI) as a potent negative regulator of adipogenesis and modulator of autocrine/paracrine adipogenic factors. | |
| 21496456 | 2011 | Adiponectin induces the transforming growth factor decoy receptor BAMBI in human hepatocytes. | |
| 20886049 | 2010 | BAMBI is expressed in endothelial cells and is regulated by lysosomal/autolysosomal degradation. | |
| 20634891 | 2010 | Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia. | |
| 20513241 | 2010 | The TGF-beta-pseudoreceptor BAMBI is strongly expressed in COPD lungs and regulated by nontypeable Haemophilus influenzae. | |
| 20189233 | 2010 | BAMBI is overexpressed in ovarian cancer and co-translocates with Smads into the nucleus upon TGF-beta treatment. | |
| 19998449 | 2010 | Polymorphisms in the transforming growth factor beta 1 pathway in relation to colorectal cancer progression. | |
| 19758997 | 2009 | Human BAMBI cooperates with Smad7 to inhibit transforming growth factor-beta signaling. | |
| 19328798 | 2009 | A colorectal cancer expression profile that includes transforming growth factor beta inhibitor BAMBI predicts metastatic potential. | |
| 19326429 | 2009 | BAMBI gene is epigenetically silenced in subset of high-grade bladder cancer. | |
| 18838381 | 2008 | The pseudoreceptor BMP and activin membrane-bound inhibitor positively modulates Wnt/beta-catenin signaling. | |
| 18756595 | 2008 | Prognostic significance of BMP and activin membrane-bound inhibitor in colorectal cancer. | |
| 16189514 | 2005 | Towards a proteome-scale map of the human protein-protein interaction network. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15340161 | 2004 | Signal peptide prediction based on analysis of experimentally verified cleavage sites. | |
| 15240101 | 2004 | Transcriptional regulation of the TGF-beta pseudoreceptor BAMBI by TGF-beta signaling. | |
| 15164054 | 2004 | The DNA sequence and comparative analysis of human chromosome 10. | |
| 14660579 | 2004 | Identification of BMP and activin membrane-bound inhibitor (BAMBI), an inhibitor of transforming growth factor-beta signaling, as a target of the beta-catenin pathway in colorectal tumor cells. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12107411 | 2002 | Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts. | |
| 10942595 | 2000 | A visual intracellular classification strategy for uncharacterized human proteins. | |
| 8621228 | 1996 | Expression of nma, a novel gene, inversely correlates with the metastatic potential of human melanoma cell lines and xenografts. | |
| 8125298 | 1994 | Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides. |
