Property Summary

NCBI Gene PubMed Count 31
PubMed Score 118.83
PubTator Score 51.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.400 6.4e-07
psoriasis -1.200 5.5e-06
glioblastoma 1.300 1.7e-02
cystic fibrosis -1.627 1.1e-06
group 4 medulloblastoma -1.600 1.4e-05
intraductal papillary-mucinous adenoma (... -1.400 1.2e-02
lung cancer 3.300 2.2e-06
colon cancer 2.900 1.3e-04
interstitial cystitis -2.100 1.0e-05
pilocytic astrocytoma 2.800 1.2e-08
aldosterone-producing adenoma -1.378 4.1e-02
lung carcinoma 3.300 1.2e-45
ductal carcinoma in situ 2.200 2.2e-02
invasive ductal carcinoma 3.500 5.9e-04
ovarian cancer -3.100 3.3e-12

Protein-protein Interaction (4)

Gene RIF (21)

PMID Text
26258650 TGFbeta target genes including TGFBI, BAMBI, COL3A1 and SERPINE1 are significantly increased in Diamond Blackfan Anemia induced pluripotent stem cells
24912656 betacatenin expression was downregulated as a result of knocking down of BAMBI, and TGF-beta was downregulated in a similar manner.
24798646 The observations illuminated that BAMBI inhibits adipogenesis by a feedback loop (BAMBI-->beta-catenin nuclear translocation-->BAMBI), which forms with Wnt/beta-catenin signaling.
24752577 BAMBI alone or in combination with Smad7 was significantly associated with the OS and DFS. These findings suggest that BAMBI and Smad7 may cooperatively inhibit the TGF-beta signaling, and thus promote the progression of gastric cancer.
24448807 study demonstrates that LPS- and TNF-alpha-induced NF-kappaBp50-HDAC1 interaction represses BAMBI transcriptional activity, which contributes to TLR4-mediated enhancement of TGF-beta signaling in hepatic stellate cells during liver fibrosis.
23807684 Overexpression of BAMBI is associated with the growth and invasion of human osteosarcoma.
22406377 Metformin-mediated Bambi expression in hepatic stellate cells induces prosurvival Wnt/beta-catenin signaling
22187378 Alterations in BAMBI may play a role in the (patho)physiology of obesity, and manipulation of BAMBI may present a novel therapeutic approach to improve adipose tissue function.
21496456 Data show that hepatoprotective effects of adiponectin include induction of BAMBI which is reduced in human fatty liver.
20886049 BAMBI protein is expressed in endothelial cells and is regulated by autophagy and lysosomal degradation.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20513241 Expression of the TGF pseudoreceptor BAMBI in the human lung, which is upregulated in response to nontypeable Haemophilus influenzae infection in COPD lung tissue in vivo and in vitro.
20189233 Authors demonstrate for the first time a nuclear co-translocation of BAMBI with Smad2/3 upon TGF-geta treatment. Moreover, overexpression of BAMBI in an in vitro model led to significantly increased proliferation.
19998449 Observational study of gene-disease association. (HuGE Navigator)
19758997 Mechanistically, in addition to interfering with the complex formation between the type I and type II receptors, hBAMBI cooperates with Smad7 to inhibit TGF-beta signaling
19328798 A colorectal cancer expression profile that includes transforming growth factor beta inhibitor BAMBI predicts metastatic potential.
19326429 hypermethylation of the BAMBI gene promoter that leads to BAMBI gene suppression may be one of the epigenetic events affecting the invasiveness or aggressiveness of bladder cancers
18838381 BAMBI interacts with Wnt receptor Frizzled5, coreceptor LRP6, and Dishevelled2 and increases the interaction between Frizzled5 and Dishevelled2
18756595 BAMBI was linked to a potentially aggressive tumor phenotype and predicted tumor recurrence and cancer-related death in CRC.
15240101 Our findings suggest that BAMBI transcription is regulated by TGF-beta signaling through direct binding of SMAD3 and SMAD4 to the BAMBI promoter.
14660579 beta-catenin interferes with transforming growth factor-beta-mediated growth arrest by inducing the expression of BAMBI

AA Sequence

MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCL      1 - 70
DSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQ     71 - 140
ELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAK    141 - 210
LDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV                        211 - 260
//

Text Mined References (31)

PMID Year Title
26258650 2015 Dysregulation of the Transforming Growth Factor ? Pathway in Induced Pluripotent Stem Cells Generated from Patients with Diamond Blackfan Anemia.
24912656 2014 Knockdown of BAMBI inhibits ?-catenin and transforming growth factor ? to suppress metastasis of gastric cancer cells.
24798646 2014 BMP and activin membrane-bound inhibitor (BAMBI) inhibits the adipogenesis of porcine preadipocytes through Wnt/?-catenin signaling pathway.
24752577 2014 Expression of BAMBI and its combination with Smad7 correlates with tumor invasion and poor prognosis in gastric cancer.
24448807 2014 Transcriptional repression of the transforming growth factor ? (TGF-?) Pseudoreceptor BMP and activin membrane-bound inhibitor (BAMBI) by Nuclear Factor ?B (NF-?B) p50 enhances TGF-? signaling in hepatic stellate cells.
23807684 2013 The overexpression of BAMBI and its involvement in the growth and invasion of human osteosarcoma cells.
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
22406377 2012 Metformin-mediated Bambi expression in hepatic stellate cells induces prosurvival Wnt/?-catenin signaling.
22187378 2012 Identification of BMP and activin membrane-bound inhibitor (BAMBI) as a potent negative regulator of adipogenesis and modulator of autocrine/paracrine adipogenic factors.
21496456 2011 Adiponectin induces the transforming growth factor decoy receptor BAMBI in human hepatocytes.
20886049 2010 BAMBI is expressed in endothelial cells and is regulated by lysosomal/autolysosomal degradation.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20513241 2010 The TGF-beta-pseudoreceptor BAMBI is strongly expressed in COPD lungs and regulated by nontypeable Haemophilus influenzae.
20189233 2010 BAMBI is overexpressed in ovarian cancer and co-translocates with Smads into the nucleus upon TGF-beta treatment.
19998449 2010 Polymorphisms in the transforming growth factor beta 1 pathway in relation to colorectal cancer progression.
19758997 2009 Human BAMBI cooperates with Smad7 to inhibit transforming growth factor-beta signaling.
19328798 2009 A colorectal cancer expression profile that includes transforming growth factor beta inhibitor BAMBI predicts metastatic potential.
19326429 2009 BAMBI gene is epigenetically silenced in subset of high-grade bladder cancer.
18838381 2008 The pseudoreceptor BMP and activin membrane-bound inhibitor positively modulates Wnt/beta-catenin signaling.
18756595 2008 Prognostic significance of BMP and activin membrane-bound inhibitor in colorectal cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15240101 2004 Transcriptional regulation of the TGF-beta pseudoreceptor BAMBI by TGF-beta signaling.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14660579 2004 Identification of BMP and activin membrane-bound inhibitor (BAMBI), an inhibitor of transforming growth factor-beta signaling, as a target of the beta-catenin pathway in colorectal tumor cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
10942595 2000 A visual intracellular classification strategy for uncharacterized human proteins.
8621228 1996 Expression of nma, a novel gene, inversely correlates with the metastatic potential of human melanoma cell lines and xenografts.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.