Property Summary

NCBI Gene PubMed Count 268
PubMed Score 156.30
PubTator Score 503.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia 1.300 2.5e-02
ovarian cancer 1.500 1.2e-09
psoriasis 1.200 3.0e-54

Protein-protein Interaction (4)

Gene RIF (196)

PMID Text
26743580 E6 proteins of human papillomavirus types 6 and 11 are able to protect keratinocytes from apoptosis via Bak degradation.
26668309 A Novel Naphthalimide Compound Restores p53 Function in Non-small Cell Lung Cancer by Reorganizing the Bak.Bcl-xl Complex and Triggering Transcriptional Regulation.
26610208 Findings argue for auto-activation of Bak in the absence of anti-apoptotic Bcl-2 proteins and provide evidence of profound differences in the activation of Bax and Bak.
26494789 high BAK expression correlates with sensitivity of clinical acute myelogenous leukemia to chemotherapy, whereas low BAK levels correlate with resistance and relapse
26417093 Motifs of VDAC2 required for mitochondrial Bak import and tBid-induced apoptosis.
26406239 Report shows that high Bak expression is associated with the favorable overall survival rates of breast cancer patients.
26378049 LTX-315 kills cancer cells through Bax/Bak-regulated mitochondrial membrane permeabilization
26179084 Different selenium concentrations had varying effects on BAK1 and APAF1 levels. APAF1 may play an important role in the pathogenesis of KBD
26134559 Data show that mitochondrial X-linked inhibitor of apoptosis protein (XIAP) entry requires apoptosis regulatory proteins Bax or Bak through mitochondrial permeabilization and Smac/DIABLO protein degradation.
26030884 Puma is the major mediator of virus-induced Bax/Bak activation and mitochondrial membrane permeabilization induction.
25999420 Studies show that necrosis requires Bcl-2-associated protein x (Bax) and Bcl-2 homologues antagonist/killer (Bak), which can regulate the permeability characteristics of the outer mitochondrial membrane.
25906158 Data with full-length proteins indicate that most BH3-only proteins can directly activate both Bak and Bax.
25893290 Low expression of pro-apoptotic Bak protein in in Waldenstrom macroglobulinemia.
25880232 alpha1 dissociation is a key step in unfolding Bak into three major components, the N terminus, the core (alpha2-alpha5) and the latch (alpha6-alpha8) that is required for apoptosis.
25773855 By down-regulating Bak, P53, P21, BRCA1, BCL-Xl.
25744027 Bak apoptotic pores involve a flexible C-terminal region and juxtaposition of the C-terminal transmembrane domains.
25715028 the BH3 mimetic ABT-737 induces autophagy through a BAX and BAK1-independent mechanism that likely involves disruption of BECN1 binding to antiapoptotic BCL2 family members
25649765 BMX directly inhibits a core component of the intrinsic apoptosis machinery opens opportunities to improve the efficacy of existing chemotherapy by potentiating BAK-driven cell death in cancer cells.
25617717 Results show that in thyroid tumours and cell lines, VDAC2 is upregulated and BAK1 downregulated. Also, transient knockdown of VDAC2 promoted upregulation of the BAK1 expression, and increased susceptibility to sorafenib treatment.
25446129 enhanced efficacy of combination of mdivi-1 and death ligands is not dependent on the originally reported target of mdivi-1, Drp1, and is also not dependent on the two important pro-apoptotic Bcl-2 family proteins Bax and Bak
25408501 Data show that E3 ubiquitin-protein ligase HERC1 interacts with bcl-2 homologous antagonist-killer protein BAK in HPV5 E6-expressing cells that have been damaged by UV.
25378477 the reduction of Bax shuttling to the level of Bak retrotranslocation results in full Bax toxicity even in absence of apoptosis induction.
25304383 Clitocine may activate Bak by disrupting the interaction between Mcl-1.
25275009 The mitochondrial metalloprotease OMA1 was activated in a Bax- and Bak-dependent fashion.
25246614 Caspase 8 cleavage by HIV protease activates BAK, enabling HIV to kill infected T cells.
25228770 Helices contribute to mitochondrial outer membrane perforation in that oligomers Bak alpha5 (like Bax alpha5) remain part of the protein core and a membrane-impermeable cysteine reagent labels cysteines placed at many positions in alpha5 and alpha6 of both Bak and Bax.
25175025 Data shows that Bak undergoes a conformational change similar to that of Bax upon activation.
25012639 Chk1 activity is required for BAK multimerization in association with PUMA during mitochondrial apoptosis
24970817 Data show that proto-oncogene protein ERBB3 knockdown resulted in cell cycle arrest and activation of Bak and Bax-dependent apoptosis.
24901052 Rapamycin-enhanced mitomycin C-induced apoptotic death is mediated through the S6K1-Bad-Bak pathway in peritoneal carcinomatosis.
24850748 Authors demonstrate that during vaccinia virus infection, engagement of Bim and Bak by F1L is crucial for subversion of host cell apoptosis.
24794530 Bak interacts with Mtx2 together with VDAC2 in resting cells and with Mtx1 upon induction of apoptosis.
24739951 HIV-1 Tat induces apoptosis of human blood-retinal barrier-associated cells by downregulation of BCL2 and upregulation of BAK, BAX, and cytochrome c in a dose-dependent manner
24680709 Imperatorin is a Mcl-1 degradation inducer that can effectively suppress multidrug-resistant human liver cancer growth via Bax/Bak pathway.
24672785 The Bak and Bax genes expressions were analyzed in 23 breast cancer patients.
24643683 our data strongly support an important role for miR-125b on conferring TMZ resistance through targeting Bak1 expression.
24532468 data highlight a novel molecular interaction between miR-150 and BAK1 and provide a novel strategy for non-small cell lung cancer therapy via the down-regulation of miR-150 expression
24265320 these results provide strong evidence that Puma, like Bim, Noxa, and tBid, is able to act as a direct Bak activator.
24162660 This progress has resolved longstanding controversies, but has also challenged established theories in the apoptosis field, it focus on the recent progress made in characterizing the proapoptotic Bax and Bak.
24130482 In vitro IFNalpha/beta stimulation enhanced Bak expression, CD95/Fas expression and CD95/Fas-mediated apoptosis in healthy donor T cells and induced death of HIV-specific CD8+ T cells from HIV-1-infected patients.
24100034 Bax and BakDeltaC21 follow similar mechanisms of membrane permeabilization characterized by the formation of protein-permeable pores of dynamic size, in agreement with the proteolipidic nature of these apoptotic pores.
24097825 Phosphorylated Bcl-2, Bcl-2 S70E, and Bcl-2 S70A exhibit enhanced binding to Bim and Bak compared with unmodified Bcl-2.
24074954 Therefore, BID and BIM have nonoverlapping roles in the induction of apoptosis via BAK and BAX, affecting chemotherapy response.
23966164 Baseline Bax and Bak expression may serve as biomarkers for patients with Burkitt lymphoma likely to respond to histone deacetylase inhibitors treatment.
23954445 Mcl-1 knock-down resulted in marked cleavage of PARP and induction of apoptosis. Down-regulation of Bcl-2 or Bcl-xL had a much weaker effect.
23954442 zinc-binding protein-89 upregulates the expression of Bak by targeting multiple components of the epigenetic pathway in hepatocellular carcinoma.
23928699 OCT4 directly induces expression of miR-125b, which inhibits its direct target BAK1, leading to suppression of cervical cancer cell apoptosis.
23798675 CXCR4 chemokine receptor signaling induces apoptosis in acute myeloid leukemia cells via regulation of the Bcl-2 family members Bcl-XL, Noxa, and Bak.
23604079 BAK activation follows a 'hit-and-run' mechanism whereby BID dissociates from the trigger site, which allows BAK oligomerization at an overlapping interface.
23480852 BAK activation increases ceramide synthase levels and ceramide accumulation in tumor cell lines.
23443079 G-Rh2 causes rapid and dramatic translocation of both Bak and Bax, which subsequently triggers mitochondrial cytochrome c release and consequent caspase activation.
23404709 activation of both BAK and BAX is initiated by direct BH3-interaction but at distinct trigger sites.
23389372 data indicate that somatic mutation of BAX and BAK genes are rare in the common cancers (besides the cancers with high microsatellite instability) and suggest that neither BAX nor BAK mutation may causally be implicated in their tumorigenesis
23303126 Bak is not significantly phosphorylated at any residue, and Bak activation during apoptosis does not require dephosphorylation.
23283967 the direct interaction of Bax and Bak proteins with Bcl-2 homology domain 3 (BH3)-only proteins in living cells is revealed by fluorescence complementation
23242420 These results suggested that calpain, Bak and Atg5 were molecular links between autophagy and apoptosis and revealed novel aspects of the crosstalk between these two processes.
23229512 Bak is necessary and sufficient for VK2-induced cytochrome c (cyt c) release and cell death.
23217248 Letter: demonstrate the role of MHC loci other than BAK1 in influencing platelets blood counts.
23192964 Diva binds peptides derived from the BH3 domain of several other proapoptotic Bcl-2 proteins, including mouse Harakiri, Bid, Bak and Bmf.
23189150 BAK multimerization requires removal of inhibitory phosphorylation at the hydrophobic groove, mediated by PP2A, in the stepwise process of activation.
23140172 Demonstrate that P2Y(12) activation protects platelets from apoptosis via PI3k-dependent Bak/Bax inactivation.
22719244 Sequence and structural alignment revealed that a hub was conserved in the Bak amino acid sequence, and in the 3D structure of folded Bak.
22686245 Unstimulated neutrophils from chronic obstructive pulmonary disease patients had significantly lower Bak mRNA expression.
22526391 Bax/Bak knockdown and wild-type CNE2 cells showed the same kinetics of cytochrome c release.
22515821 The study reports the first NMR solution structure of a photoswitchable peptide derived from the proapoptotic protein BAK in complex with the antiapoptotic protein bcl-xL.
22504646 Dendritic cells (DC) stimulated by known inducers of DC apoptosis are characterized by high levels and activation of the proapoptotic protein BAK.
22493436 Results indicate that a protective role for Bak during ionophore-induced cell death may be closely associated with its regulatory effect on maintenance of autophagic flux and vacuole homeostasis.
22479585 Withanolide D elicits apoptosis in malignant cells through Bax/Bak dependent pathway in p53-wild type cells, whereas Bak compensates against loss of Bax in p53-null cells
22440942 Study concluded that disturbances in the expression of p53, Bax, Bcl-xL and Bak proteins are associated with their involvement in the process of carcinogenesis in the stomach.
22378505 These data firstly demonstrate that ART induces Bak-mediated caspase-independent intrinsic apoptosis in which Bim and VDAC2 as well as AIF play important roles in both ASTC-a-1 and A549 cell lines.
22354970 p14(ARF)-induced apoptosis in p53 protein-deficient cells is mediated by BH3-only protein-independent derepression of Bak protein through down-regulation of Mcl-1 and Bcl-xL proteins
22297299 There is strong translational arrest of N-Bak mRNA in the neurons. This arrest is partially mediated by 50-untranslated region of Bak mRNA and it is not released during mitochondrial apoptosis.
22257632 These findings suggested the dysregulation of the apoptosis-related proteins MCL1 and BAK1 in multiple sclerosis.
22253918 An up-regulation at the transcriptional level of both pro-apoptotic Bak and pro-survival myeloid cell leukemia-1 (Mcl-1), is reported.
22188816 Findings suggest that sorafenib attenuates (-)-gossypol-induced Mcl-1 upregulation in androgen-independent prostate cancer cells (AI-PC) in cell death pathway that may depend on the level of Bak.
22072546 A significant association was found for rs210138 in BAK1 and pediatric germ cell tumors.
22065578 the diterpenoid compound induces a structural and functional conversion of Bcl-2 through Bim to permeabilize the mitochondrial outer membrane, thereby inducing apoptosis independently of Bax and Bak.
22056880 Bax and Bak are functionally redundant, but they are counteracted by distinct anti-apoptotic Bcl-2 family proteins in different species
22024133 Mcl-1 is complexed with Bak (but not Bax or Noxa) in untreated cells; Bak becomes activated in concert with loss of Mcl-1 expression.
21852253 likely that BAK1 polymorphisms studies not susceptibility loci for rheumatoid arthritis and systemic lupus erythematosus.
21823019 Down-regulation of Bak1 suppressed cisplatin-induced apoptosis.
21727192 The observations indicate that transient protein-protein interactions involving the Bak BH3-binding groove initiate Bak oligomerization and activation.
21726118 immunohistochemical investigation of variables involved in expression of Bak (alongside STAT3 and Bcl-xL) in endometrioid adenocarcinoma tissue: Bak and Bcl-xL are expressed in cytoplasm in some patients; expression in ERalpha +/- tissues
21658363 Co-stimulation of oxidized low density lipoprotein with interleukin-10 for 24h inhibited Bak1 expression to 28.4+/-7.2% (mRNA) and 25.7+/-6.3% (protein).
21656147 Plasminogen K5 activates mitochondrial apoptosis pathway in endothelial cells by regulating Bak and Bcl-x(L) subcellular distribution
21617256 variants in or near BAK1, DMRT1, TERT-CLPTM1L, and KITLG predispose to familial and bilateral TGCT.
21233848 Data suggest that expression of Bak can be induced by both, p53 and p73 utilizing different binding sites within the bak promoter.
21196599 Reconstitution of proapoptotic BAK function in liposomes reveals a dual role for mitochondrial lipids in the BAK-driven membrane permeabilization process.
21159883 DPV022 encoded an inhibitor of apoptosis and interacted with cellular Bak and Bax.
21158936 Bak differential expression among melanoma subtypes confirms the importance of the apoptotic pathway as a contributor to melanoma aggressiveness.
21148306 The BH3 alpha-helical mimic BH3-M6 disrupts Bcl-X(L), Bcl-2, and MCL-1 protein-protein interactions with Bax, Bak, Bad, or Bim and induces apoptosis in a Bax- and Bim-dependent manner.
21041309 BH3 peptides other than Bim and Bid exhibited various degrees of direct activation of the effector Bax or Bak
21036904 Heterodimerization of BAK and MCL-1 activated by detergent micelles.
20978950 Survivin and Bak1 mRNA were considerable markers for the identification of breast cancer patients with bone metastasis.
20959805 On apoptotic stimulation Bak undergoes dephosphorylation at tyrosine residue 108 (Y108), a critical event that is necessary but not sufficient for Bak activation.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20855536 Observational study of gene-disease association. (HuGE Navigator)
20836993 Bcl-xL can substitute for the loss of Mcl-1 whereas Bcl-2, incapable of forming a high affinity complex with Bak, could not.
20629644 expression of PARP, Bak and p53 was significantly greater for patients afflicted with varicocele than was the case for the normal controls
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20561923 Subtilase cytotoxin of Escherichia coli did not change the expression of anti-apoptotic Bcl-2 or Bcl-XL and pro-apoptotic Bax or Bak, but triggered Bax and Bak conformational changes and association of Bax with Bak.
20503275 BH3 mimetic S1 potently induces Bax/Bak-dependent apoptosis by targeting both Bcl-2 and Mcl-1
20460378 MicroRNA-125b confers the resistance of breast cancer cells to paclitaxel through suppression of pro-apoptotic Bcl-2 antagonist killer 1 (Bak1) expression
20453000 Observational study of gene-disease association. (HuGE Navigator)
20428767 oligomerization of Bak was partially responsible for the increased apoptosis in cells treated with both CGP37157 and TRAIL
20308427 Mcl-1 rather than Bcl-xL is a major target for sensitization of Bax-deficient tumors for death receptor-induced apoptosis via the Bak pathway
20034877 Interference of Bak expression inhibits the apoptosis of human granulosa cells, and the inhibitory effect can be enhanced by simultaneous Bax interference.
19955184 Data suggest that F1L replaces the antiapoptotic activity of Mcl-1 during vaccinia virus infection by interacting with Bak using highly divergent BH domains.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898928 genetic polymorphism in patients with ataxia telangiectasia is associated with the disease progression
19898928 Observational study of gene-disease association. (HuGE Navigator)
19875445 Membrane-associated XIAP induces mitochondrial outer membrane permeabilization leading to cytochrome c and Smac release, which is dependent on Bax and Bak.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19587033 Bak is more important than Bax for the induction of apoptosis in HeLa cells with recombinant wild-type VSV
19514060 different BAK1 variants can exist in both diseased and nondiseased abdominal aortic tissues, suggesting that selection may be a significant factor in abdominal aortic aneurysms ontogeny
19481066 Bz-423 superoxide signals B cell apoptosis via MCL1, BAK, and BAX.
19463775 Gemtuzumab ozogamicin (GO)-induced proapoptotic activation of Bax, Bak, and stress-activated protein kinase indicate an important role for these signal proteins in the regulation of GO sensitivity in AML.
19381065 Galphas augments gamma ray-induced apoptosis by up-regulation of Bak expression via CREB and AP-1 in H1299 lung cancer cells.
19351886 the ability of Bcl-2 to protect cells from activated Bak depends on two important contextual variables, the identity of the Bcl-2 present and the amount expressed
19343496 The additional loss of Bak expression, as observed in one JCaM1.6 subclone, rendered the cells resistant to apoptosis.
19282307 results indicated that this polymorphic gene influences the risk for Sjogren syndrome, Systemic Lupus Erythematosus and Rheumatoid Arthritis in women from north-western Colombia, adding to the theory of a common genetic origin of autoimmune diseases.
19282307 Observational study of gene-disease association. (HuGE Navigator)
19255499 A member of proapoptotic Bcl-2 family, BAK, was required for HIP1R to induce cell death, while BAX was dispensable.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19168699 IL-6 induces Bcl-2 expression to perform cytoprotective functions in response to oxygen toxicity, and that this effect is mediated by alterations in the interactions between Bak and Mfn1/Mfn2.
19135534 The crystal structure and chemical properties of Bak homodimers formed through a cystine bridge (Cys166) were studied.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19056676 BAX and BAK proteins are required for cyclin-dependent kinase inhibitory drugs to cause apoptosis
19041633 These results suggest that Bak activation may occur upstream of caspase activation in Triton X-100- but not deoxycholate-induced apoptosis.
18927073 Caspase-mediated Bak activation and cytochrome c release during intrinsic apoptotic cell death in Jurkat cells.
18715924 several of the beta-HPV types possess the ability to protect UV-treated keratinocytes from apoptosis by reducing levels of Bak in those cells, thus blocking the intrinsic apoptotic pathway.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18665919 thrombin induces activation and mitochondrial translocation of Bid, Bax and Bak, and evokes mitochondrial membrane depolarization
18636124 Observational study of gene-disease association. (HuGE Navigator)
18593893 The transcriptional status of four key genes, thymidylate synthase (TYMS), MORF-related gene X (MRGX), Bcl2-antagonist/killer (BAK), and ATPase, Cu(2+) transporting beta polypeptide (ATP7B), can accurately predict response to 5-FU.
18524770 BAK oligomerization by p53 utilizes conserved residues of the p53 DNA binding domain
18472157 Prolonged hypoxia-reoxygenation caused the most severe villous apoptotic changes, increased the expression of Bax and Bak mRNA and protein and reduced the expression of Bcl-2 mRNA.
18471982 Data demonstrate that Bak oligomerization involves insertion of the BH3 domain of one Bak molecule into the groove of another and may produce symmetric Bak dimers.
18413764 ABT-737 augments TRAIL-induced cell killing by unsequestering Bim and Bak and enhancing a Bax conformational change induced by TRAIL.
18362892 Hierarchical involvement of Bak, VDAC1 and Bax in cisplatin-induced cell death.
18349538 Downregulation of Bak expression in normal enterocytes contributes to abnormal growth and tumorigenesis.
18299329 BI-1 and Bcl-X(L) operate downstream of or parallel to Bax/Bak
18251703 data indicate that Bim, Bak, and Bax actively mediate osteoblast apoptosis induced by trophic factor withdrawal
18178565 distinctions in the behaviors of Bcl-B and Mcl-1 relative to the other anti-apoptotic Bcl-2 family members, where Bcl-B and Mcl-1 display reciprocal abilities to bind and neutralize Bax and Bak.
18056640 transfection of synthetic miR-125b stimulated androgen-independent growth of Cprostate cancer cells and down-regulated the expression of Bak1
17991745 Galpha(s) protects neuroblastoma cells from hydrogen peroxide-induced apoptosis by repressing Bak induction.
17880809 We conclude that alteration in the expression of proapoptotic (Bax, Bak) and antiapoptotic (Bcl-2, Bcl-XL) proteins on surface of thyroid follicular cells may play a role in the pathogenesis of thyroid autoimmune disorders.
17879944 Histone H1.2 was translocated from the nucleus to the mitochondria after treatment with bleomycin and co-localized with Bak in mitochondria.
17724463 Bak-positive cells showed an increased sensitivity to apoptosis induction by staurosporine.
17699158 Bcl-x(L) interacts with the DNA binding site of p53, but Bak does not interact with this site
17698840 Mcl-1 confers TRAIL resistance by serving as a buffer for Bak, Bim, and Puma, and sorafenib is a potential modulator of TRAIL sensitivity
17686864 FPV039 is a functional Bcl-2 homologue that inhibits apoptosis by neutralizing the proapoptotic Bcl-2 family member Bak.
17513609 mitochondria-mediated cell death by DATS is associated with ROS generation and regulated by Bax/Bak but independent of Bcl-2 or Bcl-xL
17235284 Activation of Bak is required to release cytochrome c from the mitochondria, and is necessary to accomplish DNA damage and Neisseria gonorrhoeae-induced apoptosis.
17227835 GX15-070 induced apoptosis in vitro in MCL cell lines and primary cells from patients with MCL by releasing Bak from Mcl-1 and Bcl-X(L).
17188240 Our results confirm that ultrasound induces apoptosis via a pathway that involves Bak, Bcl-2, and caspases, but not ROS.
17074758 in addition to interacting with the pro-apoptotic protein Bak, vaccinia F1L also functions to indirectly inhibit the activation of Bax, likely by interfering with the pro-apoptotic activity of BH3-only proteins such as BimL
17015472 inhibiting the fission machinery in Bax/Bak-mediated apoptosis, by down-regulating of Drp1 or hFis1, prevents the fragmentation of the mitochondrial network
16988840 Observational study of gene-disease association. (HuGE Navigator)
16978419 Mycobacterium leprae inhibits apoptosis in THP-1 cells by downregulation of Bak and upregulation of Mcl-1 gene expression.
16874066 In Bax(-/-)/Bak(-/-) cells a nonapoptotic pathway dependent on sustained autophagy commits the oxidatively damaged cells to death.
16847458 p14(ARF) triggers apoptosis via a Bax/Bak-dependent pathway in p53-proficient cells.
16794010 Bcl-xL exerts an inhibitory effect over Bak via heterodimerization
16529740 Bak function was found to be regulated in two distinct steps by two SAP kinases, MEKK1 and JNK1 when human melanoma cells were treated with cisplatin, and the two-step regulation may be important for control of mitochondrial factor release and apoptosis.
16439990 Vaccinia virus F1L uses a specific, BH3-like domain to bind and inhibit Bak at the mitochondria.
16436379 Helicobacter pylori vacuolating cytotoxin induces activation of the proapoptotic proteins Bax and Bak
16410245 activation of the c-Abl-PKCdelta-Rac1-p38 MAPK pathway in response to ionizing radiation signals conformational changes of Bak and Bax, resulting in mitochondrial activation-mediated apoptotic cell death in human non-small cell lung cancer cells
16376985 may contribute to the higher level of constitutive apoptosis in cultures of cytotrophoblasts compared to syncytiotrophoblasts
16172118 proteolytic activation of Bid and the subsequent induction of the mitochondrial apoptotic pathway through Bax/Bak is essential for apoptosis triggered by caspase-2
15846589 Bak protein and its gene polymorphism may participate in the pathology and susceptibility of primary Sjogren's syndrome
15757910 VDAC-2 inhibits the Bak-mediated apoptotic response via Bax
15638362 There may be a dominance expression of proapoptotic proteins in optic nerve axons in glaucoma.
15638360 Expression may be useful for better characterising and predicting the prognosis of oral squamous cell carcinoma.
15478112 Results describe the expression of Bak and Bcl-2 in primary human breast cancers.
15467752 establish distinct roles for Bax and Bak in linking the TRAIL death receptor pathway to the mitochondrial apoptosis signaling cascade and delineate a higher degree of specificity in signaling for cell death by multidomain Bcl-2 homologs
15351796 evaluated the expression of Bcl-2, Bax and Bak in patients with Graves Disease (GD); findings suggest that the differential expression of Bcl-2 family proteins in both thyrocytes and lymphoid follicles may be involved in the pathology of GD
15322047 Activation of Bak was inhibited in Chlamydia trachomatis infected Hela cells.
15248898 Overexpression of the BAK gene can lead to apoptosis of gastric cancer cells in vitro, which does not appear to be dependent on p53 status.
15194786 Myxoma virus M11L can interact with Bak independently of any involvement with Bax; conclude that M11L inhibits, in a species-independent fashion, apoptotic signals mediated by activation of Bak
15159409 results suggest that Fas antigen stimulation not only activates caspase-8, but also a distinct signaling pathway involving protein kinase(s) to induce exposure of the N terminus of Bak protein
15124764 both Bak and Bcl-2 were found to be increased in correlation with an immune marker (beta2-microglobulin) in white and gray matter and plaque compared with corresponding cortical regions
15077116 These results are consistent with a model in which p53 and Mcl1 have opposing effects on mitochondrial apoptosis by interacting with, and modulating the activity of, the death effector Bak.
15003505 Identification of a Bak homologue, Bak-like, that regulates apoptosis.
14647456 suggestion that Bak is a regulatory molecule involved in IFNgamma-facilitated TRAIL-mediated apoptosis in thyroid cancer cells
12808108 Bax and Bak have roles in Bid-mediated apoptosis
12454021 functional cooperation between Bax and Bak in cell hypoxia
12297281 caspase 3-independent function of Bak in the TNF-alpha-induced apoptotic pathway
12176904 conformational changes of Bak are among the early steps in the induction of cell death
11964315 Erythrocyte survival is suppressed by a Bak-derived BH3 peptide that interacts with membrane-associated Bcl-X(L).
11940658 calpain-mediated Bid cleavage and calpain-independent Bak modulation: two separate pathways in cisplatin-induced apoptosis
11932420 limits Adenovirus replication through apoptosis induction
11929871 Bcl-2 family member Bfl-1/A1 sequesters truncated bid to inhibit is collaboration with pro-apoptotic Bak or Bax.
11908704 Bak mRNA and its protein were overexpressed in the intestinal lesions of coeliac disease patients
11867266 analyzed expression in leiomyomas and myometrium from fertile and menopausal women
11795669 Paracrine suppression of apoptosis by cytokine-stimulated neutrophils involves divergent regulation of NF-kappaB, Bcl-X(L), and Bak

AA Sequence

MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSST      1 - 70
MGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLAL     71 - 140
HVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFK    141 - 210
S//

Text Mined References (273)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26743580 2016 E6 proteins from low-risk human papillomavirus types 6 and 11 are able to protect keratinocytes from apoptosis via Bak degradation.
26668309 2016 A Novel Naphthalimide Compound Restores p53 Function in Non-small Cell Lung Cancer by Reorganizing the Bak·Bcl-xl Complex and Triggering Transcriptional Regulation.
26610208 2015 In non-transformed cells Bak activates upon loss of anti-apoptotic Bcl-XL and Mcl-1 but in the absence of active BH3-only proteins.
26494789 2015 Constitutive BAK activation as a determinant of drug sensitivity in malignant lymphohematopoietic cells.
26417093 2015 Motifs of VDAC2 required for mitochondrial Bak import and tBid-induced apoptosis.
26406239 2015 High Bak Expression Is Associated with a Favorable Prognosis in Breast Cancer and Sensitizes Breast Cancer Cells to Paclitaxel.
26378049 2015 The oncolytic peptide LTX-315 kills cancer cells through Bax/Bak-regulated mitochondrial membrane permeabilization.
26179084 2016 The Roles of the Interaction of BCL2-Antagonist/Killer 1, Apoptotic Peptidase Activating Factor 1 and Selenium in the Pathogenesis of Kashin-Beck Disease.
26134559 2015 Bax/Bak-dependent, Drp1-independent Targeting of X-linked Inhibitor of Apoptosis Protein (XIAP) into Inner Mitochondrial Compartments Counteracts Smac/DIABLO-dependent Effector Caspase Activation.
26030884 2015 Phylogenetically Distant Viruses Use the Same BH3-Only Protein Puma to Trigger Bax/Bak-Dependent Apoptosis of Infected Mouse and Human Cells.
26004684 2015 Small-Molecule Bcl2 BH4 Antagonist for Lung Cancer Therapy.
25999420 2015 Regulated necrotic cell death: the passive aggressive side of Bax and Bak.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25906158 2015 Bid chimeras indicate that most BH3-only proteins can directly activate Bak and Bax, and show no preference for Bak versus Bax.
25893290 2016 Low expression of pro-apoptotic Bcl-2 family proteins sets the apoptotic threshold in Waldenström macroglobulinemia.
25880232 2015 Dissociation of Bak ?1 helix from the core and latch domains is required for apoptosis.
25773855 2015 Silibilin-induces apoptosis in breast cancer cells by modulating p53, p21, Bak and Bcl-XL pathways.
25744027 2015 Bak apoptotic pores involve a flexible C-terminal region and juxtaposition of the C-terminal transmembrane domains.
25715028 2015 BAX and BAK1 are dispensable for ABT-737-induced dissociation of the BCL2-BECN1 complex and autophagy.
25649765 2015 BMX Negatively Regulates BAK Function, Thereby Increasing Apoptotic Resistance to Chemotherapeutic Drugs.
25617717 2015 The proteomic 2D-DIGE approach reveals the protein voltage-dependent anion channel 2 as a potential therapeutic target in epithelial thyroid tumours.
25446129 2015 Mitochondrial division inhibitor 1 (mdivi-1) enhances death receptor-mediated apoptosis in human ovarian cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25408501 2015 Resistance to UV-induced apoptosis by ?-HPV5 E6 involves targeting of activated BAK for proteolysis by recruitment of the HERC1 ubiquitin ligase.
25378477 2015 Differential retrotranslocation of mitochondrial Bax and Bak.
25304383 2014 Clitocine induces apoptosis and enhances the lethality of ABT-737 in human colon cancer cells by disrupting the interaction of Mcl-1 and Bak.
25296756 2014 Plasminogen kringle 5 induces endothelial cell apoptosis by triggering a voltage-dependent anion channel 1 (VDAC1) positive feedback loop.
25275009 2014 Activation of mitochondrial protease OMA1 by Bax and Bak promotes cytochrome c release during apoptosis.
25246614 2014 Casp8p41 generated by HIV protease kills CD4 T cells through direct Bak activation.
25228770 2014 Apoptotic pore formation is associated with in-plane insertion of Bak or Bax central helices into the mitochondrial outer membrane.
25175025 2014 Bak core and latch domains separate during activation, and freed core domains form symmetric homodimers.
25012639 2014 Chk1 activity is required for BAK multimerization in association with PUMA during mitochondrial apoptosis.
24970817 2014 ERBB3 knockdown induces cell cycle arrest and activation of Bak and Bax-dependent apoptosis in colon cancer cells.
24901052 2014 Rapamycin-enhanced mitomycin C-induced apoptotic death is mediated through the S6K1-Bad-Bak pathway in peritoneal carcinomatosis.
24850748 2014 Structural insight into BH3 domain binding of vaccinia virus antiapoptotic F1L.
24794530 2014 Metaxins 1 and 2, two proteins of the mitochondrial protein sorting and assembly machinery, are essential for Bak activation during TNF alpha triggered apoptosis.
24680709 2014 Imperatorin induces Mcl-1 degradation to cooperatively trigger Bax translocation and Bak activation to suppress drug-resistant human hepatoma.
24672785 2014 Evaluation of Bax and Bak gene mutations and expression in breast cancer.
24643683 2014 miR-125b inhibitor enhance the chemosensitivity of glioblastoma stem cells to temozolomide by targeting Bak1.
24532468 2014 Down-regulation of miR-150 induces cell proliferation inhibition and apoptosis in non-small-cell lung cancer by targeting BAK1 in vitro.
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
24265320 2014 Evaluation of the BH3-only protein Puma as a direct Bak activator.
24162660 2014 Building blocks of the apoptotic pore: how Bax and Bak are activated and oligomerize during apoptosis.
24130482 2013 Type I interferon upregulates Bak and contributes to T cell loss during human immunodeficiency virus (HIV) infection.
24100034 2013 Proapoptotic Bax and Bak proteins form stable protein-permeable pores of tunable size.
24097825 2013 Contribution of Bcl-2 phosphorylation to Bak binding and drug resistance.
24074954 2013 BID preferentially activates BAK while BIM preferentially activates BAX, affecting chemotherapy response.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23966164 2013 Loss of the proteins Bak and Bax prevents apoptosis mediated by histone deacetylase inhibitors.
23954445 2013 Simultaneous knock-down of Bcl-xL and Mcl-1 induces apoptosis through Bax activation in pancreatic cancer cells.
23954442 2013 Epigenetic upregulation of Bak by ZBP-89 inhibits the growth of hepatocellular carcinoma.
23928699 2013 OCT4 promotes tumorigenesis and inhibits apoptosis of cervical cancer cells by miR-125b/BAK1 pathway.
23798675 2013 CXCR4 chemokine receptor signaling induces apoptosis in acute myeloid leukemia cells via regulation of the Bcl-2 family members Bcl-XL, Noxa, and Bak.
23782464 2013 BAK multimerization for apoptosis, but not bid binding, is inhibited by negatively charged residue in the BAK hydrophobic groove.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
23680104 2013 The novel BH3 ?-helix mimetic JY-1-106 induces apoptosis in a subset of cancer cells (lung cancer, colon cancer and mesothelioma) by disrupting Bcl-xL and Mcl-1 protein-protein interactions with Bak.
23666240 2013 Identification of nine new susceptibility loci for testicular cancer, including variants near DAZL and PRDM14.
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
23604079 2013 BID-induced structural changes in BAK promote apoptosis.
23480852 2013 BAK activation is necessary and sufficient to drive ceramide synthase-dependent ceramide accumulation following inhibition of BCL2-like proteins.
23443079 2012 Ginsenoside Rh2 induces human hepatoma cell apoptosisvia bax/bak triggered cytochrome C release and caspase-9/caspase-8 activation.
23404709 2013 Direct activation of full-length proapoptotic BAK.
23389372 2012 Rare somatic mutation of pro-apoptotic BAX and BAK genes in common human cancers.
23303126 2013 Bak apoptotic function is not directly regulated by phosphorylation.
23283967 2013 Direct interaction of Bax and Bak proteins with Bcl-2 homology domain 3 (BH3)-only proteins in living cells revealed by fluorescence complementation.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23242420 2013 Calpain, Atg5 and Bak play important roles in the crosstalk between apoptosis and autophagy induced by influx of extracellular calcium.
23229512 2013 Vitamin K2 covalently binds to Bak and induces Bak-mediated apoptosis.
23217248 2013 Comparative analysis in cynomolgus macaque identifies a novel human MHC locus controlling platelet blood counts independently of BAK1.
23192964 2012 Nuclear magnetic resonance study of protein-protein interactions involving apoptosis regulator Diva (Boo) and the BH3 domain of proapoptotic Bcl-2 members.
23189150 2012 Blockade of the BAK hydrophobic groove by inhibitory phosphorylation regulates commitment to apoptosis.
23140172 2013 P2Y12 protects platelets from apoptosis via PI3k-dependent Bak/Bax inactivation.
23055042 2012 Human Bop is a novel BH3-only member of the Bcl-2 protein family.
22934019 2012 The endoplasmic reticulum stress response in aging and age-related diseases.
22719244 2012 Charge profile analysis reveals that activation of pro-apoptotic regulators Bax and Bak relies on charge transfer mediated allosteric regulation.
22700719 2012 Common variation at 6p21.31 (BAK1) influences the risk of chronic lymphocytic leukemia.
22686245 2012 Delayed apoptosis by neutrophils from COPD patients is associated with altered Bak, Bcl-xl, and Mcl-1 mRNA expression.
22526391 2012 Betulinic acid induces Bax/Bak-independent cytochrome c release in human nasopharyngeal carcinoma cells.
22516262 2012 Chemical genomics identifies small-molecule MCL1 repressors and BCL-xL as a predictor of MCL1 dependency.
22515821 2012 NMR solution structure of a photoswitchable apoptosis activating Bak peptide bound to Bcl-xL.
22504646 2012 Autocrine TNF is critical for the survival of human dendritic cells by regulating BAK, BCL-2, and FLIPL.
22493436 2012 Nigericin-induced impairment of autophagic flux in neuronal cells is inhibited by overexpression of Bak.
22479585 2012 Bak compensated for Bax in p53-null cells to release cytochrome c for the initiation of mitochondrial signaling during Withanolide D-induced apoptosis.
22440942 2012 Immunohistochemical assessment of apoptosis-associated proteins: p53, Bcl-xL, Bax and Bak in gastric cancer cells in correlation with clinical and pathomorphological factors.
22423221 2012 A meta-analysis and genome-wide association study of platelet count and mean platelet volume in african americans.
22378505 2012 Artesunate induces apoptosis via a Bak-mediated caspase-independent intrinsic pathway in human lung adenocarcinoma cells.
22354970 2012 p14(ARF)-induced apoptosis in p53 protein-deficient cells is mediated by BH3-only protein-independent derepression of Bak protein through down-regulation of Mcl-1 and Bcl-xL proteins.
22297299 2012 mRNA for N-Bak, a neuron-specific BH3-only splice isoform of Bak, escapes nonsense-mediated decay and is translationally repressed in the neurons.
22257632 2012 Aberrant expression of the apoptosis-related proteins BAK and MCL1 in T cells in multiple sclerosis.
22253918 2012 Up-regulation of Mcl-1 and Bak by coronavirus infection of human, avian and animal cells modulates apoptosis and viral replication.
22188816 2012 Sorafenib sensitizes (-)-gossypol-induced growth suppression in androgen-independent prostate cancer cells via Mcl-1 inhibition and Bak activation.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
22072546 2012 Associations between variants in KITLG, SPRY4, BAK1, and DMRT1 and pediatric germ cell tumors.
22065578 2012 Natural diterpenoid compound elevates expression of Bim protein, which interacts with antiapoptotic protein Bcl-2, converting it to proapoptotic Bax-like molecule.
22056880 2012 Predominant requirement of Bax for apoptosis in HCT116 cells is determined by Mcl-1's inhibitory effect on Bak.
22024133 2012 Cdk1/cyclin B plays a key role in mitotic arrest-induced apoptosis by phosphorylation of Mcl-1, promoting its degradation and freeing Bak from sequestration.
22013210 2011 The unfolded protein response: integrating stress signals through the stress sensor IRE1?.
22006182 2011 Active Bax and Bak are functional holins.
21852253 2012 Association study of BAK1 gene polymorphisms in Spanish rheumatoid arthritis and systemic lupus erythematosus cohorts.
21823019 2011 miR-125b confers resistance of ovarian cancer cells to cisplatin by targeting pro-apoptotic Bcl-2 antagonist killer 1.
21727192 2011 Transient binding of an activator BH3 domain to the Bak BH3-binding groove initiates Bak oligomerization.
21726118 2011 STAT3 and apoptosis regulators: Bak and Bcl-xL in endometrioid adenocarcinomas of different estrogen receptor-? immunoprofile.
21658363 2011 Interleukin-10 down-regulates oxLDL induced expression of scavenger receptor A and Bak-1 in macrophages derived from THP-1 cells.
21656147 2011 Plasminogen K5 activates mitochondrial apoptosis pathway in endothelial cells by regulating Bak and Bcl-x(L) subcellular distribution.
21617256 2011 Variants in or near KITLG, BAK1, DMRT1, and TERT-CLPTM1L predispose to familial testicular germ cell tumour.
21269460 2011 Initial characterization of the human central proteome.
21233848 2011 Differential regulation of the proapoptotic multidomain protein Bak by p53 and p73 at the promoter level.
21196599 2011 Reconstitution of proapoptotic BAK function in liposomes reveals a dual role for mitochondrial lipids in the BAK-driven membrane permeabilization process.
21159883 2011 Deerpox virus encodes an inhibitor of apoptosis that regulates Bak and Bax.
21158936 2011 A novel biomarker harvesting nanotechnology identifies Bak as a candidate melanoma biomarker in serum.
21148306 2011 The BH3 alpha-helical mimic BH3-M6 disrupts Bcl-X(L), Bcl-2, and MCL-1 protein-protein interactions with Bax, Bak, Bad, or Bim and induces apoptosis in a Bax- and Bim-dependent manner.
21132008 2011 Mcl-1 is critical for survival in a subgroup of non-small-cell lung cancer cell lines.
21041309 2011 BH3 domains other than Bim and Bid can directly activate Bax/Bak.
21036904 2010 Heterodimerization of BAK and MCL-1 activated by detergent micelles.
20978950 2011 Significance of survivin and Bcl-2 homologous antagonist/killer mRNA in detection of bone metastasis in patients with breast cancer.
20959805 2010 Tyrosine dephosphorylation is required for Bak activation in apoptosis.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20836993 2011 Anti-apoptotic Bcl-2 fails to form efficient complexes with pro-apoptotic Bak to protect from Celecoxib-induced apoptosis.
20629644 2010 Effects of varicocele upon the expression of apoptosis-related proteins.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20561923 2010 Subtilase cytotoxin induces apoptosis in HeLa cells by mitochondrial permeabilization via activation of Bax/Bak, independent of C/EBF-homologue protein (CHOP), Ire1alpha or JNK signaling.
20503275 2011 A novel BH3 mimetic S1 potently induces Bax/Bak-dependent apoptosis by targeting both Bcl-2 and Mcl-1.
20460378 2010 MicroRNA-125b confers the resistance of breast cancer cells to paclitaxel through suppression of pro-apoptotic Bcl-2 antagonist killer 1 (Bak1) expression.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20428767 2010 Specific mitochondrial calcium overload induces mitochondrial fission in prostate cancer cells.
20308427 2010 Endogenous Bak inhibitors Mcl-1 and Bcl-xL: differential impact on TRAIL resistance in Bax-deficient carcinoma.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20034877 2009 [Inhibitory effect of RNA interference targeting BaxBak on apoptosis of human granulosa cells].
19968986 2010 Mcl-1(128-350) fragment induces apoptosis through direct interaction with Bax.
19955184 2010 Vaccinia virus F1L interacts with Bak using highly divergent Bcl-2 homology domains and replaces the function of Mcl-1.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898928 2010 BAK, BAX, and NBK/BIK proapoptotic gene alterations in Iranian patients with ataxia telangiectasia.
19875445 2010 Role for X-linked Inhibitor of apoptosis protein upstream of mitochondrial permeabilization.
19820697 2009 A genome-wide meta-analysis identifies 22 loci associated with eight hematological parameters in the HaemGen consortium.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19587033 2009 Vesicular stomatitis virus induces apoptosis primarily through Bak rather than Bax by inactivating Mcl-1 and Bcl-XL.
19514060 2009 BAK1 gene variation and abdominal aortic aneurysms.
19483681 2009 A genome-wide association study of testicular germ cell tumor.
19481066 2009 Bz-423 superoxide signals B cell apoptosis via Mcl-1, Bak, and Bax.
19463775 2009 Deficient activation of Bak and Bax confers resistance to gemtuzumab ozogamicin-induced apoptotic cell death in AML.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19381065 2009 Stimulatory heterotrimeric G protein augments gamma ray-induced apoptosis by up-regulation of Bak expression via CREB and AP-1 in H1299 human lung cancer cells.
19351886 2009 Context-dependent Bcl-2/Bak interactions regulate lymphoid cell apoptosis.
19343496 2009 The additional loss of Bak and not the lack of the protein tyrosine kinase p56/Lck in one JCaM1.6 subclone caused pronounced apoptosis resistance in response to stimuli of the intrinsic pathway.
19282307 2010 Bcl-2 antagonist killer 1 (BAK1) polymorphisms influence the risk of developing autoimmune rheumatic diseases in women.
19255499 2009 HIP1R interacts with a member of Bcl-2 family, BCL2L10, and induces BAK-dependent cell death.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19168699 2009 IL-6 protects against hyperoxia-induced mitochondrial damage via Bcl-2-induced Bak interactions with mitofusins.
19135534 2009 Novel dimerization mode of the human Bcl-2 family protein Bak, a mitochondrial apoptosis regulator.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19060904 2009 An empirical framework for binary interactome mapping.
19056676 2008 BAX and BAK proteins are required for cyclin-dependent kinase inhibitory drugs to cause apoptosis.
19041633 2009 Differential roles for Bak in Triton X-100- and deoxycholate-induced apoptosis.
18927073 2008 Caspase-mediated Bak activation and cytochrome c release during intrinsic apoptotic cell death in Jurkat cells.
18715924 2008 E6 proteins from multiple human betapapillomavirus types degrade Bak and protect keratinocytes from apoptosis after UVB irradiation.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18665919 2008 Thrombin induces activation and translocation of Bid, Bax and Bak to the mitochondria in human platelets.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18593893 2008 Single-cell transcription site activation predicts chemotherapy response in human colorectal tumors.
18524770 2008 Oligomerization of BAK by p53 utilizes conserved residues of the p53 DNA binding domain.
18472157 2008 Bax, Bak and mitochondrial oxidants are involved in hypoxia-reoxygenation-induced apoptosis in human placenta.
18471982 2008 To trigger apoptosis, Bak exposes its BH3 domain and homodimerizes via BH3:groove interactions.
18413764 2008 BH3 mimetic ABT-737 potentiates TRAIL-mediated apoptotic signaling by unsequestering Bim and Bak in human pancreatic cancer cells.
18387192 2008 A pathway sensor for genome-wide screens of intracellular proteolytic cleavage.
18362892 2008 Hierarchical involvement of Bak, VDAC1 and Bax in cisplatin-induced cell death.
18349538 2008 Malignant transformation of normal enterocytes following downregulation of Bak expression.
18309324 2008 No death without life: vital functions of apoptotic effectors.
18299329 2008 BI-1 regulates endoplasmic reticulum Ca2+ homeostasis downstream of Bcl-2 family proteins.
18251703 2008 Bim, Bak, and Bax regulate osteoblast survival.
18178565 2008 Differential regulation of Bax and Bak by anti-apoptotic Bcl-2 family proteins Bcl-B and Mcl-1.
18056640 2007 An androgen-regulated miRNA suppresses Bak1 expression and induces androgen-independent growth of prostate cancer cells.
17991745 2008 Stimulatory heterotrimeric GTP-binding protein inhibits hydrogen peroxide-induced apoptosis by repressing BAK induction in SH-SY5Y human neuroblastoma cells.
17927446 2007 Induction of BIM is essential for apoptosis triggered by EGFR kinase inhibitors in mutant EGFR-dependent lung adenocarcinomas.
17880809 2007 [Analysis of intracellular proapoptotic (Bax, Bak) and antiapoptotic (Bcl-2, Bcl-XL) proteins expression in thyrocytes from young patients with immune and non-immune thyroid disorders].
17879944 2008 Histone H1.2 is translocated to mitochondria and associates with Bak in bleomycin-induced apoptotic cells.
17724463 2008 Activation of the mitochondrial death pathway is commonly mediated by a preferential engagement of Bak.
17699158 2007 Comparative biophysical characterization of p53 with the pro-apoptotic BAK and the anti-apoptotic BCL-xL.
17698840 2007 Mcl-1 as a buffer for proapoptotic Bcl-2 family members during TRAIL-induced apoptosis: a mechanistic basis for sorafenib (Bay 43-9006)-induced TRAIL sensitization.
17686864 2007 Fowlpox virus encodes a Bcl-2 homologue that protects cells from apoptotic death through interaction with the proapoptotic protein Bak.
17513609 2007 Mitochondria-mediated apoptosis by diallyl trisulfide in human prostate cancer cells is associated with generation of reactive oxygen species and regulated by Bax/Bak.
17446862 2007 Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1.
17386268 2007 A structural viral mimic of prosurvival Bcl-2: a pivotal role for sequestering proapoptotic Bax and Bak.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17289999 2007 Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak.
17235284 2007 Bak and Bax are non-redundant during infection- and DNA damage-induced apoptosis.
17227835 2007 The BH3-mimetic GX15-070 synergizes with bortezomib in mantle cell lymphoma by enhancing Noxa-mediated activation of Bak.
17188240 2007 Activation of Bak in ultrasound-induced, JNK- and p38-independent apoptosis and its inhibition by Bcl-2.
17157251 2006 The X-ray structure of a BAK homodimer reveals an inhibitory zinc binding site.
17097560 2006 Mechanisms of apoptosis sensitivity and resistance to the BH3 mimetic ABT-737 in acute myeloid leukemia.
17074758 2006 The vaccinia virus protein F1L interacts with Bim and inhibits activation of the pro-apoptotic protein Bax.
17015472 2006 Inhibiting the mitochondrial fission machinery does not prevent Bax/Bak-dependent apoptosis.
16988840 2007 Analysis of p53 and Bak gene mutations in lymphoproliferative disorders developing in rheumatoid arthritis.
16978419 2006 M. leprae inhibits apoptosis in THP-1 cells by downregulation of Bad and Bak and upregulation of Mcl-1 gene expression.
16874066 Deficiency in apoptotic effectors Bax and Bak reveals an autophagic cell death pathway initiated by photodamage to the endoplasmic reticulum.
16847458 2006 Bak functionally complements for loss of Bax during p14ARF-induced mitochondrial apoptosis in human cancer cells.
16794010 2006 Bcl-xL is overexpressed in hormone-resistant prostate cancer and promotes survival of LNCaP cells via interaction with proapoptotic Bak.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16645094 2006 Proapoptotic BAX and BAK modulate the unfolded protein response by a direct interaction with IRE1alpha.
16529740 2006 Two distinct steps of Bak regulation during apoptotic stress signaling: different roles of MEKK1 and JNK1.
16439990 2006 Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis.
16436379 2006 Helicobacter pylori vacuolating cytotoxin induces activation of the proapoptotic proteins Bax and Bak, leading to cytochrome c release and cell death, independent of vacuolation.
16410245 2006 Activation of Bak and Bax through c-abl-protein kinase Cdelta-p38 MAPK signaling in response to ionizing radiation in human non-small cell lung cancer cells.
16376985 Enhanced basal apoptosis in cultured term human cytotrophoblasts is associated with a higher expression and physical interaction of p53 and Bak.
16341674 2005 Transcriptome analysis of human gastric cancer.
16199525 2005 MAP-1 is a mitochondrial effector of Bax.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16172118 2005 Essential roles of the Bcl-2 family of proteins in caspase-2-induced apoptosis.
15901672 2005 Proapoptotic Bak is sequestered by Mcl-1 and Bcl-xL, but not Bcl-2, until displaced by BH3-only proteins.
15846589 2005 Immunogenetics of primary Sjögren's syndrome in Colombians.
15757910 2005 Bax-dependent regulation of Bak by voltage-dependent anion channel 2.
15638362 2004 Bcl-xl and Bak protein expression in human optic nerve axons in eyeballs post-trauma and in the eyes with absolute glaucoma.
15638360 2004 The role of Bak expression in apoptosis of the oral squamous cell carcinoma (OSCC) and metastases to lymph nodes (LNMs).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15478112 2004 Expression of the apoptotic markers in normal breast epithelium, benign mammary dysplasia and in breast cancer.
15467752 2004 Multidomain Bcl-2 homolog Bax but not Bak mediates synergistic induction of apoptosis by TRAIL and 5-FU through the mitochondrial apoptosis pathway.
15351796 2004 Immunohistochemical analysis of bcl-2, Bax and Bak expression in thyroid glands from patients with Graves' disease.
15322047 2004 Chlamydia trachomatis infection inhibits both Bax and Bak activation induced by staurosporine.
15248898 2004 BAK overexpression mediates p53-independent apoptosis inducing effects on human gastric cancer cells.
15194786 2004 Myxoma virus M11L prevents apoptosis through constitutive interaction with Bak.
15159409 2004 A caspase-8-independent signaling pathway activated by Fas ligation leads to exposure of the Bak N terminus.
15124764 2004 Bcl-2 and its homologues in the brain of patients with multiple sclerosis.
15077116 2004 Mitochondrial p53 activates Bak and causes disruption of a Bak-Mcl1 complex.
15003505 2004 Enhanced apoptosis by a novel gene, Bak-like, that lacks the BH3 domain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14647456 2004 IFNgamma sensitization to TRAIL-induced apoptosis in human thyroid carcinoma cells by upregulating Bak expression.
14596824 2003 High-throughput methods to detect dimerization of Bcl-2 family proteins.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12881569 2003 VDAC2 inhibits BAK activation and mitochondrial apoptosis.
12847083 2003 Bax and Bak can localize to the endoplasmic reticulum to initiate apoptosis.
12808108 2003 Nonredundant role of Bax and Bak in Bid-mediated apoptosis.
12721291 2003 BCL-2 selectively interacts with the BID-induced open conformer of BAK, inhibiting BAK auto-oligomerization.
12624178 2003 BAX and BAK regulation of endoplasmic reticulum Ca2+: a control point for apoptosis.
12624108 2003 Inhibition of Bid-induced apoptosis by Bcl-2. tBid insertion, Bax translocation, and Bax/Bak oligomerization suppressed.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12454021 2003 Association of Bax and Bak homo-oligomers in mitochondria. Bax requirement for Bak reorganization and cytochrome c release.
12297281 2002 Identification of a caspase 3-independent role of pro-apoptotic factor Bak in TNF-alpha-induced apoptosis.
12176904 2002 Spontaneous and drug-induced apoptosis is mediated by conformational changes of Bax and Bak in B-cell chronic lymphocytic leukemia.
12070120 2002 Cytosolic heat shock protein 60, apoptosis, and myocardial injury.
11964315 2002 Erythrocyte survival is promoted by plasma and suppressed by a Bak-derived BH3 peptide that interacts with membrane-associated Bcl-X(L).
11940658 2002 Calpain-mediated Bid cleavage and calpain-independent Bak modulation: two separate pathways in cisplatin-induced apoptosis.
11932420 2002 Bak and Bax function to limit adenovirus replication through apoptosis induction.
11929871 2002 Bcl-2 family member Bfl-1/A1 sequesters truncated bid to inhibit is collaboration with pro-apoptotic Bak or Bax.
11908704 2002 Evidences of the involvement of Bak, a member of the Bcl-2 family of proteins, in active coeliac disease.
11867266 2002 Expression of Bcl-2, Bcl-x, Mcl-1, Bax and Bak in human uterine leiomyomas and myometrium during the menstrual cycle and after menopause.
11728179 2001 Discovery of small-molecule inhibitors of Bcl-2 through structure-based computer screening.
11571294 2001 Tumor necrosis factor-alpha induces Bax-Bak interaction and apoptosis, which is inhibited by adenovirus E1B 19K.
11326099 2001 Proapoptotic BAX and BAK: a requisite gateway to mitochondrial dysfunction and death.
11175750 2001 Identification of small-molecule inhibitors of interaction between the BH3 domain and Bcl-xL.
10950869 2000 tBID, a membrane-targeted death ligand, oligomerizes BAK to release cytochrome c.
10837489 2000 MCL-1S, a splicing variant of the antiapoptotic BCL-2 family member MCL-1, encodes a proapoptotic protein possessing only the BH3 domain.
10639121 2000 Proapoptotic BH3-only Bcl-2 family members induce cytochrome c release, but not mitochondrial membrane potential loss, and do not directly modulate voltage-dependent anion channel activity.
10579309 1999 Characterization of the antiapoptotic Bcl-2 family member myeloid cell leukemia-1 (Mcl-1) and the stimulation of its message by gonadotropins in the rat ovary.
10381646 1999 Survival activity of Bcl-2 homologs Bcl-w and A1 only partially correlates with their ability to bind pro-apoptotic family members.
10381623 1999 A novel adenovirus E1B19K-binding protein B5 inhibits apoptosis induced by Nip3 by forming a heterodimer through the C-terminal hydrophobic region.
10374970 1999 Human papillomavirus (HPV) E6 interactions with Bak are conserved amongst E6 proteins from high and low risk HPV types.
10365962 1999 Bcl-2 family proteins regulate the release of apoptogenic cytochrome c by the mitochondrial channel VDAC.
10085290 1999 Cell damage-induced conformational changes of the pro-apoptotic protein Bak in vivo precede the onset of apoptosis.
9881696 1998 Inhibition of Bak-induced apoptosis by HPV-18 E6.
9878060 1999 Boo, a novel negative regulator of cell death, interacts with Apaf-1.
9843949 1998 Bax interacts with the permeability transition pore to induce permeability transition and cytochrome c release in isolated mitochondria.
9573342 1998 Genomic structure and domain organisation of the human Bak gene.
9463381 1998 The conserved N-terminal BH4 domain of Bcl-2 homologues is essential for inhibition of apoptosis and interaction with CED-4.
9111042 1997 A common binding site mediates heterodimerization and homodimerization of Bcl-2 family members.
9020082 1997 Structure of Bcl-xL-Bak peptide complex: recognition between regulators of apoptosis.
8521816 1995 A conserved domain in Bak, distinct from BH1 and BH2, mediates cell death and protein binding functions.
7715731 1995 Modulation of apoptosis by the widely distributed Bcl-2 homologue Bak.
7715730 1995 Induction of apoptosis by the Bcl-2 homologue Bak.
7715729 1995 Cloning of a bcl-2 homologue by interaction with adenovirus E1B 19K.