Property Summary

NCBI Gene PubMed Count 31
PubMed Score 13.89
PubTator Score 12.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
osteosarcoma -4.547 3.1e-13
atypical teratoid / rhabdoid tumor 2.700 2.5e-05
glioblastoma 1.100 4.0e-02
medulloblastoma 1.400 8.4e-04
medulloblastoma, large-cell 1.900 5.9e-03
pancreatic ductal adenocarcinoma liver m... 1.551 3.5e-02
non-small cell lung cancer 2.049 4.1e-26
intraductal papillary-mucinous carcinoma... 1.100 1.0e-02
intraductal papillary-mucinous neoplasm ... 1.400 5.0e-04
pancreatic cancer 1.500 3.5e-06
interstitial cystitis -2.000 5.1e-04
lung adenocarcinoma 1.200 4.6e-09
spina bifida -2.518 3.7e-02
ductal carcinoma in situ 1.500 6.6e-03
invasive ductal carcinoma 2.100 2.3e-02
ulcerative colitis 1.300 3.0e-04
ovarian cancer 3.100 2.4e-05
pituitary cancer -1.200 1.6e-05

Gene RIF (9)

PMID Text
26222696 Upregulation of BAIAP2L1 is associated with ovarian cancer.
25589496 Lacking the Bin-Amphiphysin-Rvs (BAR) dimerization domain of BAIAP2L1.
23693078 IRTKS can interact with epidermal growth factor receptor (EGFR), results in the phosphorylation of extracellular signal-regulated kinase
23175443 Identification of a novel oncogenic FGFR3-BAIAP2L1 fusion protein in bladder cancer.
21887275 These data suggest that IRTKS is a novel regulator of p53, modulating low level of MDM2-mediated p53 ubiquitination in unstressed cells.
21840312 data suggest Src-stimulated IRTKS phosphorylation is essential for its function in cell motility
21098279 Results describe the NMR structure of insulin receptor tyrosine kinase substrate (IRTKS) SH3 domain in complex with a repeat from Escherichia coli-secreted protein F-like protein encoded on prophage U (EspF(U)).
19366662 Screening of the mammalian SH3 proteome for the ability to bind EspF(U) identified the SH3 domain of insulin receptor tyrosine kinase substrate (IRTKS), a factor known to regulate the cytoskeleton.
17430976 Study characterised IRTKS, which has widespread tissue distribution, is a substrate for the insulin receptor and binds Rac, and expression of IRTKS induces clusters of short actin bundles rather than filopodia-like protrusions.

AA Sequence

MSRGPEEVNRLTESTYRNVMEQFNPGLRNLINLGKNYEKAVNAMILAGKAYYDGVAKIGEIATGSPVSTE      1 - 70
LGHVLIEISSTHKKLNESLDENFKKFHKEIIHELEKKIELDVKYMNATLKRYQTEHKNKLESLEKSQAEL     71 - 140
KKIRRKSQGSRNALKYEHKEIEYVETVTSRQSEIQKFIADGCKEALLEEKRRFCFLVDKHCGFANHIHYY    141 - 210
HLQSAELLNSKLPRWQETCVDAIKVPEKIMNMIEEIKTPASTPVSGTPQASPMIERSNVVRKDYDTLSKC    211 - 280
SPKMPPAPSGRAYTSPLIDMFNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPH    281 - 350
TAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEENETEAVTVPTPSPTPVRS    351 - 420
ISTVNLSENSSVVIPPPDYLECLSMGAAADRRADSARTTSTFKAPASKPETAAPNDANGTAKPPFLSGEN    421 - 490
PFATVKLRPTVTNDRSAPIIR                                                     491 - 511
//

Text Mined References (40)

PMID Year Title
26222696 2015 BAI1-Associated Protein 2-Like 1 (BAIAP2L1) Is a Potential Biomarker in Ovarian Cancer.
25589496 2015 Mechanism of Oncogenic Signal Activation by the Novel Fusion Kinase FGFR3-BAIAP2L1.
25519916 2014 The EHEC-host interactome reveals novel targets for the translocated intimin receptor.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23693078 2013 Insulin receptor tyrosine kinase substrate activates EGFR/ERK signalling pathway and promotes cell proliferation of hepatocellular carcinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23175443 2013 Oncogenic FGFR3 gene fusions in bladder cancer.
22921828 2012 Enterohaemorrhagic Escherichia coli exploits a tryptophan switch to hijack host f-actin assembly.
22829776 2012 A genome-wide association meta-analysis of circulating sex hormone-binding globulin reveals multiple Loci implicated in sex steroid hormone regulation.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
21887275 2011 Insulin receptor tyrosine kinase substrate enhances low levels of MDM2-mediated p53 ubiquitination.
21840312 2011 Src-stimulated IRTKS phosphorylation enhances cell migration.
21269460 2011 Initial characterization of the human central proteome.
21098279 2010 Recognition of tandem PxxP motifs as a unique Src homology 3-binding mode triggers pathogen-driven actin assembly.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19366662 2009 Insulin receptor tyrosine kinase substrate links the E. coli O157:H7 actin assembly effectors Tir and EspF(U) during pedestal formation.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18215522 2008 IRSp53: crossing the road of membrane and actin dynamics in the formation of membrane protrusions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17568789 2007 Distinctive gene expression signatures in rheumatoid arthritis synovial tissue fibroblast cells: correlates with disease activity.
17430976 2007 Characterisation of IRTKS, a novel IRSp53/MIM family actin regulator with distinct filament bundling properties.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14752106 2004 A novel actin bundling/filopodium-forming domain conserved in insulin receptor tyrosine kinase substrate p53 and missing in metastasis protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
9847074 1998 Toward a complete human genome sequence.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.