Property Summary

NCBI Gene PubMed Count 69
PubMed Score 87.88
PubTator Score 75.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.700 3.0e-03
ependymoma -2.100 5.3e-04
oligodendroglioma -1.900 2.5e-03
esophageal adenocarcinoma -1.300 1.8e-02
psoriasis 2.300 1.3e-04
glioblastoma -1.500 6.5e-06
osteosarcoma 1.228 4.4e-04
atypical teratoid / rhabdoid tumor -2.200 2.2e-07
medulloblastoma 1.200 3.5e-03
medulloblastoma, large-cell 1.400 3.1e-04
primitive neuroectodermal tumor -1.900 5.5e-04
Atopic dermatitis 1.100 2.5e-04
intraductal papillary-mucinous adenoma (... 1.100 2.5e-03
adult high grade glioma -1.600 2.1e-03
pilocytic astrocytoma -1.400 1.5e-04
Pick disease -1.100 7.9e-03

 GWAS Trait (1)

Gene RIF (36)

PMID Text
26469246 dimers sense negative membrane curvature, display a non-monotonic sorting with curvature, and expand the membrane tube at high imposed tension while constricting it at low tension
26275848 Results suggest the hypothesis that defective actin/membrane modulation in IRSp53-deficient dendritic spines may lead to social and cognitive deficits through N-methyl-d-aspartate receptor dysfunction.
26018170 HIV-1 Gag is required by RAC1-WASF2-BAIAP2-ARP3 pathway for HIV VLP production/release from Jurkat T lymphocytes
26018170 HIV-1 VLP production/release from Jurkat T lymphocytes requires an intact RAC1-WASF2-BAIAP2-ARP3 pathway as demonstrated by siRNA knockdown experiments
25031323 determined the alpha-synuclein-binding domain of beta-III tubulin and demonstrated that a short fragment containing this domain can suppress alpha-synuclein accumulation in the primary cultured cells
24584464 IRSp53 adopts a closed inactive conformation that opens synergistically with the binding of human Cdc42 to the CRIB-PR and effector proteins, such as the tumor-promoting factor Eps8, to the SH3 domain.
24392092 BAIAP2 is related to emotional modulation of human memory strength.
24377651 These above results indicated the possible involvement of BAIAP2 in the etiology of attention deficit disorder with hyperactivity, especially ADHD-I.
22767515 LIN7 is a novel regulator of IRSp53.
22179776 mDia1 and WAVE2 are important Src homology 3 domain partners of IRSp53 in forming filopodia.
21893288 Structural basis for complex formation between human IRSp53 and the translocated intimin receptor Tir of enterohemorrhagic E. coli
21814501 Studied generation of filopodia with regards to the dynamic interaction established by Eps8, IRSp53 and VASP with actin filaments.
21542353 A molecular dynamics study of the interaction between domain I-BAR of the IRSp53 protein and negatively charged membranes
20888579 The results of this study and the supporting evidence highlighted previously suggest that the BAIAP2 gene may be involved in autism susceptibility.
20678498 Cdc42 regulates the activity of IRSp53 by regulating the IRSp53-WIRE interaction as well as localization of the complex to plasma membrane to generate filopodia.
20621182 Suppression of IRSp53 expression inhibited IGF-I-induced membrane targeting and local accumulation of WAVE2 at the leading edge of cells.
20585556 HIV-1 Gag is required by RAC1-WASF2-BAIAP2-ARP3 pathway for HIV VLP production/release from Jurkat T lymphocytes
20418908 IRSp53, through its interaction with Eps8, not only affects cell migration but also dictates cellular growth in cancer cells.
20360004 IRSp53 and spinophilin regulate localized Rac activation by T-lymphocyte invasion and metastasis protein 1
19933840 this work does not conform to current views that the inverse-BAR domain or Cdc42 controls IRSp53 localization but provides an alternative model of how IRSp53 is recruited (and released) to carry out its functions at lamellipodia and filopodia.
19762983 The authors demonstrated that the association between the enterohemorrhagic Escherichia coli O157:H7 EspFu and IRSp53 induces dynamic membrane remodeling in epithelial cells.
19733838 this study support the participation of BAIAP2 in the continuity of ADHD across life span,in some of the populations analyzed, suggest that genetic factors potentially influencing abnormal cerebral lateralization may be involved in this disorder.
19733838 Observational study of gene-disease association. (HuGE Navigator)
19460367 SPIN90 and IRSp53 positively cooperated to mediate Rac activation, and co-expression of SPIN90 and IRSp53 in COS-7 cells led to the complex formation of SPIN90-IRSp53 in the leading edge of cells
19286134 The authors show that IRSp53 family members, key regulators of membrane and actin dynamics, directly interact with both Tir and EspF(U).[Tir & EspFU]
19193906 Both spatial learning and novel object recognition are impaired in transgenic mice deficient of IRSp53 expression.
19054385 LIN7-IRSp53 association plays a role during assembly of functional tight junctions and surface polarization in epithelial cells
18417251 tyrosine 310 as a primary site of tyrosine phosphorylation in response to insulin signalling and we have shown that although IRSp53 is tyrosine phosphorylated in response to epidermal growth factor receptor signalling, tyrosine 310 is not crucial.
17371834 Together, these data reveal that interplay between actin dynamics and a novel membrane-deformation activity promotes cell motility and morphogenesis.
17115031 These results support a model whereby the synergic bundling activity of the IRSp53-Eps8 complex, regulated by Cdc42, contributes to the generation of actin bundles, thus promoting filopodial protrusions.
17003044 The mechanism of membrane deforamtion induced by the IRSp53 RCB domain is reported.
16702231 Therefore, IRSp53 optimizes the activity of the WAVE2 complex in the presence of activated Rac and PIP(3).
15673667 These results suggest that PSD-95 interaction is an important determinant of synaptic IRSp53 localization and that the SH3 domain of IRSp53 links activated Rac1/Cdc42 to downstream effectors for the regulation of spine morphogenesis.
15635447 IRSp53 comprises a central SH3 domain, which binds to proline-rich regions of a wide range of actin regulators, and a conserved N-terminal IRSp53/MIM homology domain that harbours F-actin-bundling activity. Presents crystal structure of this novel domain
14752106 IRSp53, when activated by small GTPases, participates in F-actin reorganization not only in an SH3-dependent manner but also in a manner dependent on the activity of the IRSp53/MIM homology domain
14596909 LIN7B is a partner of IRSp53 anchoring the actin-based membrane cytoskeleton at cell-cell contacts.

AA Sequence

MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSK      1 - 70
ELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAE     71 - 140
LKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAA    141 - 210
YHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVP    211 - 280
PELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPK    281 - 350
NSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEK    351 - 420
TKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRP    421 - 490
YSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR            491 - 552
//

Text Mined References (76)

PMID Year Title
26469246 2015 IRSp53 senses negative membrane curvature and phase separates along membrane tubules.
26275848 2016 IRSp53/BAIAP2 in dendritic spine development, NMDA receptor regulation, and psychiatric disorders.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25519916 2014 The EHEC-host interactome reveals novel targets for the translocated intimin receptor.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25031323 2014 Dynamin1 is a novel target for IRSp53 protein and works with mammalian enabled (Mena) protein and Eps8 to regulate filopodial dynamics.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24584464 2014 Mechanism of IRSp53 inhibition and combinatorial activation by Cdc42 and downstream effectors.
24392092 2014 BAIAP2 is related to emotional modulation of human memory strength.
24377651 2013 BAIAP2 exhibits association to childhood ADHD especially predominantly inattentive subtype in Chinese Han subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24076653 2013 CDC42 switches IRSp53 from inhibition of actin growth to elongation by clustering of VASP.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22767515 2012 LIN7 regulates the filopodium- and neurite-promoting activity of IRSp53.
22179776 2012 mDia1 and WAVE2 proteins interact directly with IRSp53 in filopodia and are involved in filopodium formation.
21893288 2011 Structural basis for complex formation between human IRSp53 and the translocated intimin receptor Tir of enterohemorrhagic E. coli.
21814501 2011 The Eps8/IRSp53/VASP network differentially controls actin capping and bundling in filopodia formation.
21542353 [A molecular dynamics study of the interaction between domain I-BAR of the IRSp53 protein and negatively charged membranes].
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20888579 2011 Association study of six candidate genes asymmetrically expressed in the two cerebral hemispheres suggests the involvement of BAIAP2 in autism.
20678498 2010 The mammalian verprolin, WIRE induces filopodia independent of N-WASP through IRSp53.
20621182 2010 WAVE2 targeting to phosphatidylinositol 3,4,5-triphosphate mediated by insulin receptor substrate p53 through a complex with WAVE2.
20418908 2010 The interplay between Eps8 and IRSp53 contributes to Src-mediated transformation.
20360004 2010 Scaffold proteins IRSp53 and spinophilin regulate localized Rac activation by T-lymphocyte invasion and metastasis protein 1 (TIAM1).
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19933840 2010 Regulation of IRSp53-dependent filopodial dynamics by antagonism between 14-3-3 binding and SH3-mediated localization.
19762983 2009 Interaction between enterohemorrhagic Escherichia coli O157:H7 EspFu and IRSp53 induces dynamic membrane remodeling in epithelial cells.
19733838 2009 Case-control study of six genes asymmetrically expressed in the two cerebral hemispheres: association of BAIAP2 with attention-deficit/hyperactivity disorder.
19460367 2009 SPIN90-IRSp53 complex participates in Rac-induced membrane ruffling.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19366662 2009 Insulin receptor tyrosine kinase substrate links the E. coli O157:H7 actin assembly effectors Tir and EspF(U) during pedestal formation.
19286134 2009 IRSp53 links the enterohemorrhagic E. coli effectors Tir and EspFU for actin pedestal formation.
19193906 2009 Enhanced NMDA receptor-mediated synaptic transmission, enhanced long-term potentiation, and impaired learning and memory in mice lacking IRSp53.
19171758 2009 Kank attenuates actin remodeling by preventing interaction between IRSp53 and Rac1.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19054385 2009 LIN7 mediates the recruitment of IRSp53 to tight junctions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18448434 2008 The Cdc42 effector IRSp53 generates filopodia by coupling membrane protrusion with actin dynamics.
18417251 2008 Identification of the insulin-responsive tyrosine phosphorylation sites on IRSp53.
18215522 2008 IRSp53: crossing the road of membrane and actin dynamics in the formation of membrane protrusions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17371834 2007 Missing-in-metastasis and IRSp53 deform PI(4,5)P2-rich membranes by an inverse BAR domain-like mechanism.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17115031 2006 Regulation of cell shape by Cdc42 is mediated by the synergic actin-bundling activity of the Eps8-IRSp53 complex.
17003044 2006 The RAC binding domain/IRSp53-MIM homology domain of IRSp53 induces RAC-dependent membrane deformation.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16702231 2006 Optimization of WAVE2 complex-induced actin polymerization by membrane-bound IRSp53, PIP(3), and Rac.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15673667 2005 Regulation of dendritic spine morphogenesis by insulin receptor substrate 53, a downstream effector of Rac1 and Cdc42 small GTPases.
15635447 2005 Structural basis of filopodia formation induced by the IRSp53/MIM homology domain of human IRSp53.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15289329 2004 IRSp53/Eps8 complex is important for positive regulation of Rac and cancer cell motility/invasiveness.
14752106 2004 A novel actin bundling/filopodium-forming domain conserved in insulin receptor tyrosine kinase substrate p53 and missing in metastasis protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14596909 2003 MALS is a binding partner of IRSp53 at cell-cell contacts.
12884081 2003 Genomic structure and alternative splicing of the insulin receptor tyrosine kinase substrate of 53-kDa protein.
12598619 2003 Novel espin actin-bundling proteins are localized to Purkinje cell dendritic spines and bind the Src homology 3 adapter protein insulin receptor substrate p53.
12504591 2002 The insulin receptor substrate IRSp53 links postsynaptic shank1 to the small G-protein cdc42.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12054568 2002 WAVE2 serves a functional partner of IRSp53 by regulating its interaction with Rac.
11696321 2001 Cdc42 induces filopodia by promoting the formation of an IRSp53:Mena complex.
11157984 2001 Cdc42Hs facilitates cytoskeletal reorganization and neurite outgrowth by localizing the 58-kD insulin receptor substrate to filamentous actin.
11130076 2000 IRSp53 is an essential intermediate between Rac and WAVE in the regulation of membrane ruffling.
10814512 2000 Rho small G-protein-dependent binding of mDia to an Src homology 3 domain-containing IRSp53/BAIAP2.
10460236 1999 The insulin receptor tyrosine kinase substrate p58/53 and the insulin receptor are components of CNS synapses.
10343108 1999 Identification of BAIAP2 (BAI-associated protein 2), a novel human homologue of hamster IRSp53, whose SH3 domain interacts with the cytoplasmic domain of BAI1.
10332026 1999 Dentatorubral-pallidoluysian atrophy protein interacts through a proline-rich region near polyglutamine with the SH3 domain of an insulin receptor tyrosine kinase substrate.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.